KEGG   Trichinella spiralis: Tsp_01235Help
Entry
Tsp_01235         CDS       T01609                                 

Definition
extracellular signal-regulated kinase 1
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tsp04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tsp04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tsp04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 448 aa AA seqDB search
MALVSHQRCMPTANGETNHSLLATQSYLSGNVGTSLQNVQPDRPIGYGAFGVVWSVTDPR
SGKRVALKRMPNVFLNLASCKRVFREIRMLSSFKNDNVLSCLDILHPPNARMFVEIYVLT
ELMQSDLHKIIVSPQPLTTDHVKVFVYQILRGLLYLHSARILHRDIKPGNLLVNSNCLLK
ICDFGLARVWDPSEQATLTHEVVTQYYRAPELLMGARNYTAAVDVWSVGCIFAELLGRRI
LFQAQGPVEQLNLIIDLLGTPSVAEMRYACEGARNHVLKSPFRPPKYFKLYSLSQQATQE
AVGLLTQMLCFDPDKRITVGDALAHPYLEEGRLRFHSCMCSCCRTTSNGTRVYAQNPEPV
HSEPFDVKWEKELSRLSMFELRDRIYKFIIERAPPYHIPLCINPDSNAFKSFITRNISSF
PHISSLGIRDRSFEKTKKQNSSYTLPAV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctctggttagccaccaacgttgcatgccgaccgcaaacggcgaaactaatcacagc
cttttggcaacccaatcttatctatccggcaatgttggaacttctttgcagaatgtccag
ccagatcgaccaattggctacggtgcttttggtgttgtctggtctgttacggatccacgt
tctggaaaaagggtagcgttgaagcgtatgccgaatgtttttttaaatttagcctcatgc
aagcgcgtttttcgagaaattcgaatgctttcctctttcaaaaatgacaacgtattatca
tgcttggacattctgcatccaccaaacgctcgcatgtttgtcgaaatttatgtactcaca
gagctcatgcaaagtgatttgcacaaaattattgtctcacctcagccgttgacaactgat
catgtgaaagtgtttgtttatcagattttgagaggcttattgtatttacattcggcaaga
attcttcatcgtgatatcaagccgggtaatttgctagtcaatagcaactgcctgttgaag
atatgtgattttgggctggcccgtgtctgggatccgtcagagcaagctacactgacgcat
gaggtggttacgcagtattacagagcgccagaattgctgatgggcgccagaaattatacg
gctgccgttgatgtgtggtctgttgggtgcatttttgctgaactgcttggtcgaagaata
ttgtttcaagctcagggtccagttgaacagctcaacttaatcatcgacttgcttggcacg
ccttcagtagcggaaatgcgatacgcatgcgaaggtgcaaggaatcacgttctcaaatcg
ccattccgaccaccgaaatatttcaaattgtattctctcagtcaacaagctacccaagaa
gcggtcggcttgctcacacagatgctttgctttgatccagataaacgcataactgtcggt
gatgcacttgctcatccgtatttggaggaaggtcgacttcggttccattcgtgcatgtgc
tcttgttgtcgtaccacgtccaacggaacccgtgtttatgcacaaaatccggagccggtt
cacagtgaaccgttcgacgtgaaatgggaaaaagaattgtcacgtttgtccatgttcgag
ctcagagatcgaatttacaaattcatcattgaacgtgctcctccgtatcacattcctctg
tgcatcaatccggattcgaacgcattcaaaagctttatcacaagaaatatctcatcattt
cctcatatatcctcattaggtatcagagatcgctcatttgaaaaaacaaaaaaacaaaac
tccagctacacactgccagctgtttga

DBGET integrated database retrieval system