KEGG   Trichinella spiralis: Tsp_01235Help
Entry
Tsp_01235         CDS       T01609                                 

Definition
extracellular signal-regulated kinase 1
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_01235
   04310 Wnt signaling pathway
    Tsp_01235
   04068 FoxO signaling pathway
    Tsp_01235
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tsp_01235
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Tsp_01235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 448 aa AA seqDB search
MALVSHQRCMPTANGETNHSLLATQSYLSGNVGTSLQNVQPDRPIGYGAFGVVWSVTDPR
SGKRVALKRMPNVFLNLASCKRVFREIRMLSSFKNDNVLSCLDILHPPNARMFVEIYVLT
ELMQSDLHKIIVSPQPLTTDHVKVFVYQILRGLLYLHSARILHRDIKPGNLLVNSNCLLK
ICDFGLARVWDPSEQATLTHEVVTQYYRAPELLMGARNYTAAVDVWSVGCIFAELLGRRI
LFQAQGPVEQLNLIIDLLGTPSVAEMRYACEGARNHVLKSPFRPPKYFKLYSLSQQATQE
AVGLLTQMLCFDPDKRITVGDALAHPYLEEGRLRFHSCMCSCCRTTSNGTRVYAQNPEPV
HSEPFDVKWEKELSRLSMFELRDRIYKFIIERAPPYHIPLCINPDSNAFKSFITRNISSF
PHISSLGIRDRSFEKTKKQNSSYTLPAV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctctggttagccaccaacgttgcatgccgaccgcaaacggcgaaactaatcacagc
cttttggcaacccaatcttatctatccggcaatgttggaacttctttgcagaatgtccag
ccagatcgaccaattggctacggtgcttttggtgttgtctggtctgttacggatccacgt
tctggaaaaagggtagcgttgaagcgtatgccgaatgtttttttaaatttagcctcatgc
aagcgcgtttttcgagaaattcgaatgctttcctctttcaaaaatgacaacgtattatca
tgcttggacattctgcatccaccaaacgctcgcatgtttgtcgaaatttatgtactcaca
gagctcatgcaaagtgatttgcacaaaattattgtctcacctcagccgttgacaactgat
catgtgaaagtgtttgtttatcagattttgagaggcttattgtatttacattcggcaaga
attcttcatcgtgatatcaagccgggtaatttgctagtcaatagcaactgcctgttgaag
atatgtgattttgggctggcccgtgtctgggatccgtcagagcaagctacactgacgcat
gaggtggttacgcagtattacagagcgccagaattgctgatgggcgccagaaattatacg
gctgccgttgatgtgtggtctgttgggtgcatttttgctgaactgcttggtcgaagaata
ttgtttcaagctcagggtccagttgaacagctcaacttaatcatcgacttgcttggcacg
ccttcagtagcggaaatgcgatacgcatgcgaaggtgcaaggaatcacgttctcaaatcg
ccattccgaccaccgaaatatttcaaattgtattctctcagtcaacaagctacccaagaa
gcggtcggcttgctcacacagatgctttgctttgatccagataaacgcataactgtcggt
gatgcacttgctcatccgtatttggaggaaggtcgacttcggttccattcgtgcatgtgc
tcttgttgtcgtaccacgtccaacggaacccgtgtttatgcacaaaatccggagccggtt
cacagtgaaccgttcgacgtgaaatgggaaaaagaattgtcacgtttgtccatgttcgag
ctcagagatcgaatttacaaattcatcattgaacgtgctcctccgtatcacattcctctg
tgcatcaatccggattcgaacgcattcaaaagctttatcacaagaaatatctcatcattt
cctcatatatcctcattaggtatcagagatcgctcatttgaaaaaacaaaaaaacaaaac
tccagctacacactgccagctgtttga

DBGET integrated database retrieval system