KEGG   Trichinella spiralis: Tsp_01461Help
Entry
Tsp_01461         CDS       T01609                                 

Definition
putative diacylglycerol kinase catalytic domain protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tsp  Trichinella spiralis
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Tsp_01461
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    Tsp_01461
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Tsp_01461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 369 aa AA seqDB search
MNETAERNSHNVAVFVNPASGTGHAHSVFQRKVLPVIEKAGMTPEIFITGKDDETEKKCK
YLNISKYEKLLIVGGDGIIHELSVVLEILNGLITRSDWDEALQLPIAVLPCGSGNALAAS
AFSLPTHKMNKKELFDAALNAVVNGAPHRLKLIHVTSNLFSCYSFMSVSWGMIADIDLQS
ERFRYIFGRSRFTVEALFKIVHPKTCRGKLYYLPYGDDVDGGDDCHDNGVEVDEQDVVSL
HCEKCKFNPKSMAKWRCIDDEFLFVHASYLSHISENTLFMPVASLNDHSIYLTYMLGKDA
SKWNVFKFLWNLKTGDHLTFPFVKVIPVVAFCMQPADEGNVIMSVDGEEKKVDNHLYAHV
SEIQAAIMT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacagctgagagaaattcacataacgtagcagtttttgtcaatcctgcttct
ggaaccggccatgctcatagtgtttttcaacgcaaagttctcccagtaatagaaaaagct
ggaatgacacctgaaatttttatcacagggaaagatgatgaaactgaaaaaaaatgcaaa
tacttgaacatttcaaaatacgaaaaattgctgattgttggaggtgatggaattatacat
gagttgtcagttgtacttgagattttaaatggcctcataacacgtagtgattgggatgaa
gcactgcagttgccaattgccgttttgccttgtggatctggcaatgcacttgctgcatct
gcgttttctttgcctacccataagatgaataagaaagaattgtttgatgctgcgttgaat
gctgtggtaaatggtgctcctcatcgactcaagttgatacatgtaacttcaaatttgttc
agttgttattcatttatgtctgtcagttggggcatgatcgcagacattgatttacaaagc
gaacgatttcgttatatttttggtaggagtcgttttacagttgaagctcttttcaaaatt
gtgcatccgaaaacgtgcagaggaaagctgtactatttgccatatggagatgatgttgat
ggtggtgacgattgtcatgataatggtgtcgaggttgatgagcaagatgttgtttcattg
cactgtgaaaaatgcaaattcaatccgaaatcaatggccaaatggcgttgtatcgatgac
gaatttctgtttgtccacgcctcctatttgagtcacatatctgaaaatacactgttcatg
ccagtcgcctctctgaacgatcattccatctatttgacttacatgttgggcaaggatgct
tcgaaatggaacgtatttaaatttttgtggaacttgaaaaccggtgatcatttgacgttc
ccatttgtgaaggttatacctgtcgtcgcattttgcatgcaacctgccgacgaaggcaac
gtcatcatgtctgtagacggtgaagagaaaaaggtggataatcatttgtacgctcatgtt
tcagaaatccaagcagccattatgacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system