KEGG   Trichinella spiralis: Tsp_01601Help
Entry
Tsp_01601         CDS       T01609                                 

Definition
mitogen-activated protein kinase 1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_01601
   04012 ErbB signaling pathway
    Tsp_01601
   04350 TGF-beta signaling pathway
    Tsp_01601
   04068 FoxO signaling pathway
    Tsp_01601
   04150 mTOR signaling pathway
    Tsp_01601
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Tsp_01601
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tsp_01601
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Tsp_01601
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tsp_01601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 369 aa AA seqDB search
MERKHSAYDRVTKARVAIKKISPFEHQTFCQRTLREIKILTRFKHENIINIQDIINAPTI
EQMKDIFDNCSWLEAICCLVDKRLYNGEREGELGQVEGKMAPAYIVQCLMETDLYKLLKT
QKLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH
DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILGEMLNSRPLFPGKHYLDQLN
LILAVVGSPSEEDLQCIVNDKARSYLISLPPKEKQPWNKIYPHADQKALDLLDKMLTFNP
NRRITVEQALAHPYLEQYYDPADEPICEEPFKFEMEFDDLPKERLKELIFAQTTEFQSRK
QSSTSNQGC
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaagcactctgcttatgatcgagtcacaaaagcccgagtagcgattaagaaa
atttcaccgttcgagcatcaaacgttttgccagcgtacactcagggaaattaaaatttta
actcgatttaagcatgaaaacattataaacattcaagatattataaatgcaccgaccatt
gaacaaatgaaagatatttttgacaactgcagttggctagaagcgatctgttgcctggtt
gacaagagattgtataacggagagagggaaggggaacttgggcaagttgaggggaaaatg
gcaccagcttacattgttcaatgtctgatggagacagacttgtacaaattgctgaagact
caaaagctgtctaatgatcacatttgctattttttgtaccaaattcttcgcggtttgaag
tatattcattcggcgaacgtgctgcaccgggatctcaaaccttcaaatttgctgctaaac
actacttgcgatttaaaaatttgtgattttggacttgctcgtgttgctgatccagatcac
gatcataccggatttttaactgaatacgtcgctacgaggtggtatcgagcaccggagatt
atgctaaattcgaaaggctatacgaaaagtatagatatctggtcagttgggtgcattctg
ggcgaaatgcttaacagtcggccgcttttccccggcaagcattacttggaccaattgaat
ttgatccttgccgtggtcggctcgccttcagaagaagacctgcaatgtattgtgaacgac
aaggcacgttcttatttgatttctttaccgccaaaagaaaaacagccgtggaacaagatt
tacccgcatgcggaccaaaaggctttggatctgttggacaaaatgttgacgttcaatcca
aatcgacgcatcacagtagaacaagcacttgctcatccatatttagaacaatactatgat
ccagcagatgagccgatatgtgaagagcctttcaaatttgaaatggaatttgacgattta
ccaaaagagcgattgaaagagctaatattcgctcagacgaccgaatttcaaagtcgaaaa
cagagcagcacttcgaaccagggatgttga

DBGET integrated database retrieval system