KEGG   Trichinella spiralis: Tsp_01944Help
Entry
Tsp_01944         CDS       T01609                                 

Definition
NADH-cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tsp  Trichinella spiralis
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tsp00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MKRVLMKKKKPKMTALVAESLVSDQESGEAHEDVNMFVEKEEDKSDSGNEDEYSDDTDYD
EDLEEFSTVVDRNDTGFDEIVIFKETMCNVQVHDPQWYSSLVSNMSAEELAQLRDVFETA
ERRRVAKKQPRQKRPEKRRQVDNRKTPEKAAICFTVFVVLLAIELSKERFFGTIRNVLCH
FLTDNCTAMLNDNWITTAALLAGVGLASAAVYYYAFIKRKPKKLLEDPTVNYSIVLASKE
VCENLNKVNHDTRMFRFSLHSADQVLGLGVGQHVHLSAKINGQLVVRPYTPISDINERGS
IYFKDTHPLFPEGGKMTQYLDNLKIGDSINIRGPGGCFAIKPSKKADPVQKKYKKVAMLA
GGSGITPMYQLIKASLADSYDKLEMHLIYANKSWSFEQLSLQSEQDILLFEELLNLEMKH
PTRFRVWFTIDTRKGKVLNYFQNTVKILRGHGKCAASVSN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagttctgatgaagaagaagaaaccgaagatgacagctcttgtggcagagtcg
ttggtttcggatcaagaatcaggtgaagcgcacgaagatgtgaacatgttcgtcgaaaaa
gaggaagacaaatctgacagtggaaatgaagatgaatacagcgacgatacggactacgac
gaagatttggaagaattttctacagttgttgatcgaaatgataccggctttgatgagatt
gtgattttcaaagaaacaatgtgcaatgttcaagttcacgatccgcagtggtacagttcg
ttggttagcaacatgtcggctgaagaattggctcagctgcgtgacgttttcgaaacagca
gaacgccgacgagttgcaaagaagcagccaaggcaaaagcggccggagaagcggcgacaa
gtggacaacagaaagacgccggagaaagcagcaatttgcttcacagtgttcgtagtcttg
ttggcgattgaattgagtaaagaaagatttttcggtacaattcgcaatgttctatgtcat
tttttgacagacaactgtacggcgatgctcaacgacaactggataaccacggcagcattg
ttagccggtgttggcttggcgtcggctgctgtttattattacgcgttcatcaagcgaaag
ccgaagaaattgttggaagatcccactgtcaactacagcatagtgttggcatctaaagag
gtctgcgagaatttgaacaaagtcaatcacgacacgcgtatgtttcgattttccttgcat
tcagccgatcaagttcttggccttggtgtcgggcagcatgttcatctcagtgcgaaaatt
aacggacagctcgttgttcgcccatatacaccaattagtgatatcaatgaacgtggttct
atttacttcaaagatacgcatccactctttccagaaggaggcaaaatgacgcagtatttg
gataatttgaaaatcggtgacagtatcaatattcgtggacctggtggttgctttgcaata
aaaccgtccaagaaagccgatcctgtgcaaaagaaatataagaaagtggctatgctggct
ggcgggtcaggtataacaccaatgtaccaattaatcaaagcctcactagctgattcttac
gataaacttgaaatgcatttgatttacgcaaacaaatcatggtcgtttgaacaattgtct
ttgcagagtgagcaggatatcctgttgtttgaagagttgcttaatttggaaatgaagcat
ccaacaagatttcgtgtgtggttcacgatagatactcgcaaaggcaaagttttaaattat
ttccaaaatacggtgaagattttgcgtggacatggaaaatgtgcagcaagtgtgtcaaac
taa

DBGET integrated database retrieval system