KEGG   Trichinella spiralis: Tsp_01947Help
Entry
Tsp_01947         CDS       T01609                                 

Definition
NADH-cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tsp  Trichinella spiralis
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tsp_01947
Enzymes [BR:tsp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Tsp_01947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MKRVLMKKKKPKMTALVAESLVSDQESGEAHEDVNMFVEKEEDKSDSGNEDEYSDDTDYD
EDLEEFSTVVDRNDTGFDEIVIFKETMCNVQVHDPQWYSSLVSNMSAEELAQLRDVFETA
ERRRVAKKQPRQKRPEKRRQVDNRKTPEKAAICFTVFVVLLAIELSKERFFGTIRNVLCH
FLTDNCTTMLNDNWITTAALLAGVGLASAAVYYYAFIKRKPKKLLEDPTVNYGIVLASKE
VCENLNKVNHDTRMFRFSLHSADQVLGLGVGQHVHLSAKINGQLVVRPYTPISDINERGS
IYFKDTHPLFPEGGKMTQYLDNLKIGDSINIRGPGGCFAIKPSKKADPVQKKYKKVAMLA
GGSGIAPMYQLIKASLADSYDKLEMHLIYANKSWSFEQLSLQSEQDILLFEELLNLEMKH
PTRFRVWFTIDTRKGKVLNYFQNTVKILREHGRCAASVSN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagttctgatgaagaagaagaaaccgaagatgacagctcttgtggcagagtcg
ttggtttcggatcaagaatcaggtgaagcgcacgaagatgtgaacatgttcgtcgaaaaa
gaggaagacaaatctgacagtggaaatgaagatgaatacagcgacgatacggactacgac
gaagatttggaagaattttctacagttgttgatcgaaatgataccggctttgatgagatt
gtgattttcaaagaaacaatgtgcaatgttcaagttcacgatccgcagtggtacagttcg
ttggttagcaacatgtcggctgaagaattggctcagctgcgtgacgttttcgaaacagca
gaacgccgacgagttgcaaagaagcagccaaggcaaaagcggccggagaagcggcgacaa
gtggacaacagaaagacgccggagaaagcagcaatttgcttcacagtgttcgtagtcttg
ttggcgattgaattgagtaaagaaagatttttcggtacaattcgcaatgttctatgtcat
tttttgacagacaactgtacgacgatgctcaacgacaactggataaccacggcagcattg
ttagccggtgttggcttggcgtcggctgctgtttattattacgcgttcatcaagcgaaag
ccgaagaaattgttggaagatcccactgtcaactacggcatagtgttggcatctaaagag
gtctgcgagaatttgaacaaagtcaatcacgacacgcgtatgtttcgattttccttgcat
tcagccgatcaagttcttggccttggtgtcgggcagcatgttcatctcagtgcgaaaatt
aacggacagctcgttgttcgcccatatacaccaattagtgatatcaatgaacgtggttct
atttacttcaaagatacgcatccactctttccagaaggaggcaaaatgacgcagtatttg
gataatttgaaaatcggtgacagtatcaatattcgtggacctggtggttgctttgcaata
aaaccgtccaagaaagccgatcctgtgcaaaagaaatataagaaagtggctatgctggct
ggcgggtcaggtatagcaccaatgtaccaattaatcaaagcctcactagctgattcttac
gataaacttgaaatgcatttgatttacgcaaacaaatcatggtcgtttgagcaattgtct
ttgcagagtgagcaggatatcctgttgtttgaagagttgcttaatttggaaatgaagcat
ccaacaagatttcgtgtgtggttcacgatagatactcgcaaaggcaaagttttaaattat
ttccaaaatacggtgaagattttgcgtgagcatggaagatgtgcagcaagtgtgtcaaac
taa

DBGET integrated database retrieval system