KEGG   Trichinella spiralis: Tsp_02206Help
Entry
Tsp_02206         CDS       T01609                                 

Definition
dual specificity mitogen-activated protein kinase kinase 3
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tsp04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 414 aa AA seqDB search
MSRQMLQKLSASNSLLLICDMQERFRNTIDFFPEIVQVAQRLLEGSKLLGVPVVATEQYP
KGAIKSKRKVNVAKIAVSNAPFSVPKPPANLEDHFSVKINDTLYEIRAEDLIRIKELGRG
SYGIVETMLHSASNTVFAVKRIHLTVNDEEQKRMLIELNTSMKSGSCPHMVQFYGAMFRE
GDVWLCMEAMDLSLDKFYRMCVDQKRIIPDFVLCKIARSIVEALHYMKQELNLMHRDVKP
SNVLLNRKGEIKICDFGISGHLTDSLAKTINAGCKPYMAPERINPHDEAQHAYDIRSDVW
SLGITMIEVATGNHPYSKWKTPFEQLKQVVMDSPPKLPNRNFSEEFESFVELCLKKNFKE
RPKYKDLLEHPFLKRFENCENDVAAFINEVLNDANCGAVSEIASTLHKLSVSES
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgacaaatgttgcaaaaattatctgcaagcaattcattgctgctcatctgtgac
atgcaagaacgatttcgcaatacaatcgactttttcccggaaatagtgcaagtggctcag
cgccttttggaaggttccaaactgttgggtgtacctgttgtggcaacggaacaatatccg
aaaggtgcaattaaatcaaaaagaaaagtcaatgttgcgaaaattgcagtgtccaacgca
ccattctcggttcccaaaccccctgcaaacttagaggaccatttttcggtcaaaatcaat
gacactttgtatgaaattcgagctgaagatcttattcgcattaaagaactcggtcgtgga
agctatggaattgtggaaacgatgctgcactctgcttcaaatacagtttttgctgtgaaa
agaattcatttaacagtaaatgatgaagagcaaaaacgaatgttaatcgaattaaataca
agcatgaaaagtggcagttgtccacatatggtgcagttttatggagcaatgtttcgtgaa
ggcgacgtttggttgtgcatggaagcaatggatttgtcgttggataagttttatcgcatg
tgtgtagaccagaaacgcataataccagattttgttttatgcaaaattgcgcgttcaatt
gtggaagcgttgcattacatgaagcaggagttaaatttgatgcaccgggatgtaaaacct
agcaatgttcttttaaatcgaaaaggagaaattaaaatttgcgactttggcatcagtggc
catctaactgactcattggccaagacgataaatgctggttgcaaaccatacatggcgcca
gaaagaattaatccgcacgatgaagcccagcacgcttatgacatccgatcggatgtttgg
agtcttggtataacaatgatagaagtggccacgggtaatcatccttactcaaagtggaaa
actccatttgaacaattgaagcaagttgtcatggattctccgccaaaactgcctaacagg
aatttttccgaagaatttgaaagttttgtagaattatgtttgaagaaaaatttcaaagaa
cgtccgaaatacaaagatctgcttgagcatccatttctaaaaagatttgaaaactgtgaa
aatgatgttgcagcttttatcaatgaagttttgaatgatgctaactgcggtgcagtcagc
gaaattgcttcaactttgcacaagctatccgtttcagaatcgtaa

DBGET integrated database retrieval system