KEGG   Trichinella spiralis: Tsp_02250Help
Entry
Tsp_02250         CDS       T01609                                 

Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tsp  Trichinella spiralis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Tsp_02250
Translation factors [BR:tsp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Tsp_02250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 658 aa AA seqDB search
MATGEHEDDPNKVLTDDGEEPSFSDPEDYVDNCTDEELIPDLLKAKPVDDDGSHFVIVVD
NIPKVGPDRLPKLKAIMGKIFSKFGKVVEEFYPLSNNETKGYCFVEFGSKTNAEEAAVVL
NGYKLDKNHTFVVNLENEFEKYNNPEPNFQKPVARPYKDNGNLKSWLLNEECIDQFVMQS
GFADFKAGTYWNTFPEPTLICEKKNWSETSVQWSPQGTYLASVHNQGIALWGGKDFVRIN
RFCHPNVSSYDISPCEKYIITFSAPKSDNFDSSNSVIVWEIFSGDKKRSFPLTPNMIKPW
PYYKWSYDGKFLATLKDETLCIYETETFALLGKKTMPIEGIRDFEWSPTDDHLAYWVSER
GHAPGRVALMKLPEKLDIRSKNMFNMAEATIYWQKCGDNLCFKVDRYAKKKEEKCGEIKY
SGISHHLEVFHIREKEVPVTSLEVKENIQAFSWEPHGFKFAIIVGDLKTTVVFYGVRSNP
VSVVQLRILEQKNTVNAIYWAPIGHHVVFVGLKGASNGALVFVDTNVQDIIVANQQEHPG
LTHVEWDPTGRYLVTSVSIWAPNRGGDCGYVMWNFQGRMLQKKSVEEFCLFSWRPRPKPL
LSDSFIKTLLELRREEWFAEKPIRMKLRGDEDTDDLFGEENTFVEECEVFLSKEVILE
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcaactggtgagcatgaagatgatccaaacaaagtgttaactgacgatggcgaagaa
ccatccttcagtgatccagaagactatgtcgataactgcactgatgaagagttgataccg
gatttgctaaaagctaagcctgttgatgacgatggtagtcattttgttattgttgttgat
aacattccaaaagtgggtcctgaccgtttaccgaagctgaaagcaattatgggcaaaata
ttttcaaaatttggtaaagtcgtcgaagaattttacccgttgtccaataatgaaacaaaa
ggatactgcttcgtggaatttggatcgaaaacaaacgcagaggaagctgctgtggtatta
aatggttataaattggacaaaaatcatacattcgtggtcaatttagaaaatgaatttgaa
aaatataacaatccggaaccaaatttccaaaagccagttgctcgaccatacaaagataat
ggaaacttgaagtcatggttattgaatgaagagtgtatagaccagtttgtaatgcaatct
ggatttgctgactttaaagctggtacatattggaacacttttccggaaccaacgctaata
tgcgagaagaagaattggtctgaaacgagtgttcagtggtcaccgcaaggtacatatctt
gcttctgttcataatcagggtatcgctttgtggggaggaaaagattttgttcgaattaat
cgattttgtcatccaaatgtttccagctacgatatttctccctgtgaaaaatatataatt
acgttttccgcacccaagtcggataactttgattcgtcaaatagcgtgatagtctgggaa
atcttttctggtgacaagaagagaagttttcctttgacaccaaacatgatcaaaccatgg
ccatattacaagtggagctatgacggaaaatttcttgccacactgaaagatgaaacgctg
tgcatttacgagacagaaacatttgctttattgggcaagaagactatgcctattgaaggt
ataagagattttgaatggtcacctactgatgaccatcttgcttactgggtatctgagcgt
gggcatgcgcctgggagagttgcattgatgaaattgccagaaaaattggatatacgcagc
aagaacatgtttaacatggccgaagcaaccatatattggcagaagtgtggggacaatctg
tgtttcaaagttgacagatatgcgaaaaagaaagaggaaaaatgtggtgaaatcaaatac
agtggcatatcgcatcatcttgaagtatttcacattcgagaaaaggaagtaccagttact
tcattagaagtgaaagaaaacatccaagcattttcttgggaacctcatggatttaagttt
gccattatcgtcggcgatttgaaaaccactgttgttttctatggggtacgatccaatcct
gtttctgttgttcaactgagaatccttgaacagaagaatacggtaaatgccatatattgg
gcacctattggtcatcatgtagtttttgttggtttgaaaggggcttctaatggagctttg
gtatttgtcgacacaaatgtgcaggatatcattgttgctaatcagcaagagcatcctggt
ttaacgcacgtggaatgggatcccactggacgctatttggttactagcgttagcatttgg
gcaccgaatcgtggaggtgattgtggttatgtgatgtggaattttcaaggtagaatgctg
caaaagaaatcagtcgaagaattctgcttgttctcttggcgtccaagaccgaagccttta
ctgagcgacagttttattaaaacgttattggaacttcgtcgtgaagaatggttcgcagaa
aagccaattcgaatgaaactgcgaggtgacgaagatacagacgatttatttggggaagaa
aacactttcgtcgaagaatgtgaggtgttcttatcaaaggaagttattttagaatga

DBGET integrated database retrieval system