KEGG   Trichinella spiralis: Tsp_02272Help
Entry
Tsp_02272         CDS       T01609                                 

Definition
glutathione peroxidase
Organism
tsp  Trichinella spiralis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 129 aa AA seqDB search
MASKSSDKCVYDFEAKDIDGNGLRIAAFPCNQFGKQEPKSEEEIKKFATERYGVTFDMYS
KIDVNDANEHPLWHFLKSKLSGTTGTPIKWNFAKFLIDQNGVPVRRYEPDDSPNSMEPDF
VALLNKKDS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaaaagcagcgataaatgcgtttacgattttgaagcaaaagacatcgatgga
aatggcttacgtattgctgcattcccatgtaatcaattcggaaagcaggaaccaaaatca
gaggaagaaattaaaaaatttgcaacagaacgttatggagtaacatttgatatgtattca
aagattgacgtgaatgatgcaaatgaacatccattatggcattttttgaagtccaaactg
agcggaactactggaacgccaattaaatggaattttgcaaagtttctgattgatcaaaat
ggtgttccagttcgacgctatgaacctgatgattcgccaaacagtatggaacctgatttt
gtagccctgttgaacaaaaaagattcataa

DBGET integrated database retrieval system