KEGG   Trichinella spiralis: Tsp_02336Help
Entry
Tsp_02336         CDS       T01609                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tsp  Trichinella spiralis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tsp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 431 aa AA seqDB search
MEKGTCRSFRDLKSVLSKVILSGTPDLPLAVKERALSLCACFLGGAWKEVPIQKFSIQRM
SGGLSNVLLLCQHELDVYPDSAVPCKILLRIYFNPETETNVVEESVTFMLLSERQLGPKL
YGIFPGGRLEEYIPSRPLSVLEVRQSHFSRQIAAKMAQFHALSVPLSKEPTYLFDALKRW
MRQLKNNADRFPEFLVRFDNQVISLNEERLLQEINLIRDFTDNCKSPVVFCHNDIQEGGN
SFSFFFSLYNFTINLINSKLSTHQVTYFFQMNVLLTKVSCLSTLNIQVIIIGFDLANHFC
EWIFDCTITEPPGFVVEPSHFPTEAEQLQFFSSYLEELKKPVDADVLEFMLQEVSGFVPV
SHLLWGVWALLQNIVSPMQADFNFMEYAKTRMSLYFHLRPTLLRALPQYRHFLADHTDML
ELAQSQAVFTR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtacatgcagaagctttcgtgatttgaaatctgttctcagcaaagttatc
ctgagcggaacaccggatttaccactcgcggttaaagaaagggcgttgtcactttgcgca
tgttttctcggcggtgcctggaaagaagtgcctattcaaaaattttccattcaacgaatg
agcggtggcttgagtaacgttttactgttatgccagcatgagctggatgtttatccggac
agtgctgtgccgtgcaagattttattacgaatttacttcaatcctgaaacagagacgaac
gttgtcgaagaaagcgtcacatttatgctactgtcggaaagacaacttggaccgaaattg
tacggaatttttccgggcggtcgtcttgaagaatacattccgtctcgccctctttctgta
ttggaagttcgccagtcgcacttttctagacaaattgctgcgaaaatggcacaatttcac
gctctcagcgttccactaagcaaagagccgacgtatcttttcgatgcactgaaacggtgg
atgcgtcagttgaagaacaacgcggatcggtttccggaatttttagttcgtttcgacaac
caagtaatttcgctgaacgaggaaagactgttgcaagagatcaacttgatcagagatttc
accgacaattgcaaatcgccagtcgtgttttgtcacaacgacattcaagaaggtgggaat
tcattttctttctttttctctttgtacaattttacaataaatttgataaactcgaaactg
tcaacgcatcaagtaacatacttcttccaaatgaatgttcttctcacaaaggtatcatgt
ttatcgactttgaatattcaagttataattataggattcgatttagccaatcacttctgc
gaatggatattcgattgtactattaccgagcccccaggctttgttgtagaaccgtctcat
tttcccaccgaagctgaacagttgcaatttttttcttcttatttggaagaattgaaaaag
ccagtcgacgcggatgttttagaatttatgttgcaagaagtatccggtttcgtgcctgta
tcgcacttgctttggggagtttgggcattattgcaaaacatcgtttcaccaatgcaagcg
gatttcaactttatggagtatgccaaaactagaatgtccttgtattttcatttaaggccg
actttgctgcgtgcattgccgcagtatcgtcattttctagctgatcatactgacatgcta
gaactggcacagtcgcaggcagtgttcactcgatga

DBGET integrated database retrieval system