KEGG   Trichinella spiralis: Tsp_02339Help
Entry
Tsp_02339         CDS       T01609                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tsp  Trichinella spiralis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tsp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 394 aa AA seqDB search
MEKGTCRSFRDLKSVLSKVILSGTPDLPLAVKERALSLCACFLGGAWKEVPIQKFSIQRM
SGGLSNVLLLCQHELDVYPDSAVPCKILLRIYFNPETETNVVEESVTFMLLSERQLGPKL
YGIFPGGRLEEYIPSRPLSVLEVRQSHFSRQIAAKMAQFHALSVPLSKEPTYLFDALKRW
MRQLKNNADRFPEFLVRFDNQVISLNEERLLQEINLIRDFTDNCKSPVVFCHNDIQEVSR
MSMLMKQMLVQCFRGFDLANHFCEWIFDCTITEPPGFVVEPSHFPTEAEQLQFFSSYLEE
LKKPVDADVLEFMLQEVSGFVPVSHLLWGVWALLQNIVSPMQADFNFMEYAKTRMSLYFH
LRPTLLRALPQYRHFLADHTDMLELAQSQAVFTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtacatgcagaagctttcgtgatttgaaatctgttctcagcaaagttatc
ctgagcggaacaccggatttaccactcgcggttaaagaaagggcgttgtcactttgcgca
tgttttctcggcggtgcctggaaagaagtgcctattcaaaaattttccattcaacgaatg
agcggtggcttgagtaacgttttactgttatgccagcatgagctggatgtttatccggac
agtgctgtgccgtgcaagattttattacgaatttatttcaatcctgaaacagagacgaac
gttgtcgaagaaagcgtcacatttatgctactgtcggaaagacaacttggaccgaaattg
tacggaatttttccgggcggtcgtcttgaagaatacattccgtctcgccctctttctgta
ttggaagttcgccagtcgcacttttctagacaaattgctgcgaaaatggcacagtttcac
gctctcagcgttccactaagcaaagagccgacgtatcttttcgatgcactgaaacggtgg
atgcgtcagttgaagaacaacgcggatcggtttccggaatttttagttcgtttcgacaac
caagtaatttcgctgaacgaggaaagactgttgcaagagatcaacttgatcagagatttc
accgacaattgcaaatcgccagtcgtgttttgtcacaacgacattcaagaagtcagtcga
atgagcatgttaatgaaacaaatgcttgtgcaatgttttagaggattcgatttagccaat
cacttctgcgaatggatattcgattgtactattaccgagcccccaggctttgttgtagaa
ccgtctcattttcccaccgaagctgaacagttgcaatttttttcttcttatttggaagaa
ttgaaaaagccagtcgacgcggatgttttagaatttatgttgcaagaagtatccggtttc
gtgcctgtatcgcacttgctttggggagtttgggcattgttgcaaaacatcgtttcacca
atgcaagcggatttcaactttatggagtatgccaaaactagaatgtccttgtattttcat
ttaaggccgactttgctgcgtgcattgccgcagtatcgtcattttctagcagatcatact
gacatgctagaactggcacagtcgcaggcagtgttcactcgatga

DBGET integrated database retrieval system