KEGG   Trichinella spiralis: Tsp_02339Help
Entry
Tsp_02339         CDS       T01609                                 

Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
tsp  Trichinella spiralis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tsp_02339
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Tsp_02339
    2.7.1.82  ethanolamine kinase
     Tsp_02339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 394 aa AA seqDB search
MEKGTCRSFRDLKSVLSKVILSGTPDLPLAVKERALSLCACFLGGAWKEVPIQKFSIQRM
SGGLSNVLLLCQHELDVYPDSAVPCKILLRIYFNPETETNVVEESVTFMLLSERQLGPKL
YGIFPGGRLEEYIPSRPLSVLEVRQSHFSRQIAAKMAQFHALSVPLSKEPTYLFDALKRW
MRQLKNNADRFPEFLVRFDNQVISLNEERLLQEINLIRDFTDNCKSPVVFCHNDIQEVSR
MSMLMKQMLVQCFRGFDLANHFCEWIFDCTITEPPGFVVEPSHFPTEAEQLQFFSSYLEE
LKKPVDADVLEFMLQEVSGFVPVSHLLWGVWALLQNIVSPMQADFNFMEYAKTRMSLYFH
LRPTLLRALPQYRHFLADHTDMLELAQSQAVFTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtacatgcagaagctttcgtgatttgaaatctgttctcagcaaagttatc
ctgagcggaacaccggatttaccactcgcggttaaagaaagggcgttgtcactttgcgca
tgttttctcggcggtgcctggaaagaagtgcctattcaaaaattttccattcaacgaatg
agcggtggcttgagtaacgttttactgttatgccagcatgagctggatgtttatccggac
agtgctgtgccgtgcaagattttattacgaatttatttcaatcctgaaacagagacgaac
gttgtcgaagaaagcgtcacatttatgctactgtcggaaagacaacttggaccgaaattg
tacggaatttttccgggcggtcgtcttgaagaatacattccgtctcgccctctttctgta
ttggaagttcgccagtcgcacttttctagacaaattgctgcgaaaatggcacagtttcac
gctctcagcgttccactaagcaaagagccgacgtatcttttcgatgcactgaaacggtgg
atgcgtcagttgaagaacaacgcggatcggtttccggaatttttagttcgtttcgacaac
caagtaatttcgctgaacgaggaaagactgttgcaagagatcaacttgatcagagatttc
accgacaattgcaaatcgccagtcgtgttttgtcacaacgacattcaagaagtcagtcga
atgagcatgttaatgaaacaaatgcttgtgcaatgttttagaggattcgatttagccaat
cacttctgcgaatggatattcgattgtactattaccgagcccccaggctttgttgtagaa
ccgtctcattttcccaccgaagctgaacagttgcaatttttttcttcttatttggaagaa
ttgaaaaagccagtcgacgcggatgttttagaatttatgttgcaagaagtatccggtttc
gtgcctgtatcgcacttgctttggggagtttgggcattgttgcaaaacatcgtttcacca
atgcaagcggatttcaactttatggagtatgccaaaactagaatgtccttgtattttcat
ttaaggccgactttgctgcgtgcattgccgcagtatcgtcattttctagcagatcatact
gacatgctagaactggcacagtcgcaggcagtgttcactcgatga

DBGET integrated database retrieval system