KEGG   Trichinella spiralis: Tsp_02424Help
Entry
Tsp_02424         CDS       T01609                                 

Definition
ubiquitin carboxyl- hydrolase 7
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tsp  Trichinella spiralis
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Tsp_02424
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Tsp_02424
Peptidases [BR:tsp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tsp_02424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 857 aa AA seqDB search
MYKVSVINDSVLLQNGPLMKSARPVEDPYPVKVTELSEPMDKEGGNDCEKTISHVFYPKE
NDWGYSCFLRWEAVYQISTEQDDPHKSVALAMQRVFYELQFSDKPVGTKKLTLYESFKDY
VAVETLEGDNKYDAGDYGLQEATKGVVFIKFPPVLHLQLMRVQYDPLNDQNLKINDRFEF
PEKLDLDEFLESKESTPAKYTLHAVLVHSGDFHGGHYVVYINPKGNGRWCKFDDDVVSRC
SKSEAIEQNYGGNDSESAHRHCTNAYMLAYIRDSVMDEILCSVDEVDIPVQLRARLQRER
DVEALRKKEKSEAHLFCTVFVLSDDDFEGHQGPDLINTEQAERVCRKFRVRRTMTFSDVY
AYMAREYQLTPLVQFRLWPISNNDSAGGLRPTTVPNLDGLTQIDRLSSGGDLEIALYMEV
YDYLHGELELPSYRHSDDVLLFLKYYDPISQTLIYCGHMIVSIDISLTDMIPEMCARVNL
PPDTDIDIYEEDKYGDLELLDKTAESVQKACADFVDGLILVYQSVDLMKAQRGFKLAEVR
SYYIELQNRVELEFIDKQLDCVENLVIQASFEWSYIDLATVVGRRIGYDPFKIQFSRTSV
YKDSNGLAVRFSLTSKLKDILNITTRNRVRRYRLYFQRMPLRIDELELRFQVRIQYMDMK
LRVEEMIVYPSKYGTVQDLLNEVSAGIQFSEGSSKRLRLLQINSCRIVCTVQPDMVLEQM
GFNHIVRVEEIPPDQVVVDPKSEFLLPVAHFYKDCYQTFGTPFYLKVKNGEPFGSVKQRI
QRILEVSDKEFEKFKFALCTVSRTTYFENENFIINLTDFTASHFSATAKPWLGLDHVNKM
AKGRGMHTLEKAIVIHN
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgtataaggtttcagttataaatgatagtgtgcttttacagaacggtcctttgatgaag
tcggcgagacctgtcgaggatccatatcctgtaaaggtcactgagctctctgaaccaatg
gataaagaaggtggtaacgactgcgaaaagacgatctcgcatgtcttttatcccaaagag
aatgattggggttatagttgttttttgcgttgggaggcagtatatcagatttcaactgaa
caagacgatcctcataagagcgtcgcgttggctatgcagcgcgtattttacgagctgcaa
ttttccgacaagccggtcggaacgaagaaattgactctttacgaatctttcaaagattac
gtggcagtggagacgctcgaaggggataataaatacgatgcgggcgattatggtttacag
gaggcgacaaaaggtgttgtttttatcaaatttccccccgttttgcatttgcagttgatg
cgcgtccagtatgatccattgaatgatcagaatttaaaaatcaatgatcgatttgaattt
cctgaaaaacttgatttggatgaatttcttgaatcgaaagaatctaccccagcaaagtat
acattgcatgcagtgctagtccattcgggtgattttcacggcggccattatgtagtttac
atcaatccgaaaggaaatggcaggtggtgtaaatttgatgacgacgttgtttctcgatgc
tcaaaatctgaagcgattgagcagaattatggcgggaatgattccgaatccgctcatcga
cattgcactaacgcatacatgttggcatatattagggattcagtaatggatgaaatattg
tgctcagttgatgaagttgatataccagttcagttgcgtgctcgtcttcaacgggaacga
gatgtggaagcattgagaaagaaggagaaaagtgaagcgcacctgttttgcactgttttt
gtactctctgatgatgatttcgagggtcaccaaggacccgacctgatcaatactgaacaa
gcggaacgagtttgtcgtaaatttcgcgtccgccgcacgatgactttttccgacgtttac
gcttatatggcaagagaatatcaattgactcctctagttcaatttcgactgtggccaatt
tccaacaacgatagcgcaggaggattacgtcctacgactgtaccgaatcttgacggttta
actcagattgatcgattgtcttctggtggcgatctggaaattgcactgtatatggaagtt
tatgattatcttcatggtgaattggaattgccgtcctaccgtcattccgacgatgtactt
ttgtttttaaagtactacgatcccatttcgcagacgttgatctactgtgggcatatgata
gtatccattgacatttctctcactgatatgatacccgaaatgtgtgcaagagtgaattta
ccaccagataccgatattgatatttatgaagaagacaaatatggcgatttggaactgctt
gacaagacggccgaatctgtgcaaaaagcttgtgcagattttgtcgatggactcatttta
gtttatcaatctgtggatttgatgaaagcgcaacgtggtttcaagcttgcagaagtgcga
tcttactatattgaactgcaaaatcgagttgagttggaatttattgataaacagttggat
tgtgtggaaaatcttgtgattcaagcatcgttcgagtggagctacatcgatttggctact
gttgtcgggcgacgcattggttacgatccatttaaaatacagtttagtcgaacttccgta
tacaaggattcaaacgggttggctgtgcgtttcagtttgacgtcgaaattgaaagatata
ttaaacattacaactcgcaatcgagttcgtcgatacaggttatattttcaaaggatgccg
ttacgaattgatgaactagagttgcgttttcaagtccgcatccagtatatggacatgaaa
ttgagagtggaagaaatgattgtatatccgtccaaatatggcacagttcaggatttgctg
aacgaagtttctgctggtattcagttttctgagggcagctcaaaacgcttgcggttgctg
cagatcaatagttgtcgcattgtttgtaccgtacagcctgatatggttttggagcagatg
ggtttcaatcatattgttcgtgttgaagagattccgccagatcaagtggtggttgatcca
aaatcagaatttttattgccagtggctcatttttataaagattgctatcaaacgtttggt
acgccattttacttaaaagtgaagaatggcgaaccgtttggcagtgtcaaacagcgtatt
caacggatacttgaagtttcagataaagaatttgagaagtttaaatttgcattgtgcact
gtgagtcgaacaacctactttgaaaatgaaaacttcatcatcaatcttaccgactttacc
gcttctcatttttcagctaccgccaaaccatggcttggtttagatcatgttaataagatg
gcgaaggggcgaggaatgcatacgttggagaaggcgattgttattcacaattaa

DBGET integrated database retrieval system