KEGG   Trichinella spiralis: Tsp_02480Help
Entry
Tsp_02480         CDS       T01609                                 

Definition
phosphoprotein phosphatase 1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tsp  Trichinella spiralis
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tsp03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 330 aa AA seqDB search
MAADGELNVDNLISRLLEVRGTRPGRLVPMTEGEIRTLCNKSREIFLSQPILLELEAPLK
ICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDVVAKFLTRHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVLETLMCSFQVLKPGE
KKGKFQYGNFTACRPVTPPRNSDFGKKARP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggacggcgagcttaacgtggataacctaatcagtcggttgttggaagttcgt
ggtactcggccgggacgtttggtgcccatgactgagggtgaaattcgaacactgtgcaac
aagtcaagagaaatttttttgagtcaaccaattttgttggaattggaagcgccacttaaa
atctgtggtgacattcatgggcagtataatgacttgttgcgattgttcgaatatggtggc
ttcccgccagaagcgaattatttgttcctcggcgattatgtggatcgtggaaagcagtct
ttggaaactatttgtctcttgttggcgtacaagataaagtatccggaaaactttttcttg
ttgcgtggaaatcatgagtgtgctagtatcaaccgcatttatggattttacgatgaatgt
aaacgccgtttcagcatcaagttgtggaaaacgttcacagattgcttcaactgtttgcca
attgccgccatcattgacgagaaaatcttttgctgtcacggaggattgtcgccagatttg
caatcaatggagcaaattaggcgcataatgcgaccaactgatgttccagacacaggtctg
ctttgcgacttgctttggtctgatccggacaaagatgtccagggttggggtgaaaacgat
cgaggtgtctcattcacttttggacccgatgtggttgcaaagtttttgactcgtcacgat
ttggatttgatttgtcgtgcgcatcaggtcgttgaagatggttatgagttttttgcgaag
cgtcaattggttacgttgttttctgctccaaactattgtggagagtttgataatgccgga
gcgatgatgtcagtgttggaaactttgatgtgttcttttcaggtgttgaaacctggagag
aagaaaggtaaattccagtatgggaattttacagcctgtcgacctgtgacgccaccccga
aattccgatttcggaaagaaagctcggccttga

DBGET integrated database retrieval system