KEGG   Trichinella spiralis: Tsp_02482Help
Entry
Tsp_02482         CDS       T01609                                 

Definition
(RefSeq) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase classes Iand II
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tsp  Trichinella spiralis
Pathway
tsp00562  Inositol phosphate metabolism
tsp01100  Metabolic pathways
tsp04020  Calcium signaling pathway
tsp04070  Phosphatidylinositol signaling system
tsp04310  Wnt signaling pathway
tsp04933  AGE-RAGE signaling pathway in diabetic complications
Module
tsp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tsp_02482
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Tsp_02482
   04020 Calcium signaling pathway
    Tsp_02482
   04070 Phosphatidylinositol signaling system
    Tsp_02482
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Tsp_02482
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Tsp_02482
Membrane trafficking [BR:tsp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Tsp_02482
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Tsp_02482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y DUF1154 EF-hand_like Apolipoprotein
Motif
Other DBs
NCBI-GeneID: 10903092
NCBI-ProteinID: XP_003378804
UniProt: E5S0V3
Position
Unknown
AA seq 1255 aa AA seqDB search
MWNKNQKGLRDEWANSGYFGQQTWEKRKSNKGMRILYGMIKHTVHSSVFVAGSDCSCMIT
IFIHNYDVESRIDVKLHISRVEMEKWKNHKAVLSLLNTNSSFEDCLLTIVTGDTFIDLRF
HIFLASSSQSAQNWAEELFRRASNVLFRNGCVLDYLNVAYAKMRYCFGTNEIPTKDVLNL
FALNKDDRKIVEKAMVDSGLLENINLTVMKMDDLSKERCAEVKGNLTSQDEQVMSTLNDR
EFCAFLNRHQRDPRLNELLFPPFTLENARTLIEKYEIKKNLKSTRRLSFMGFLHFLLSED
SLPCNEDCLVVQEKQMNEPLAHYMINSSHNTYLTGPQVGLQAKCSAEMYRQVLISGCRCV
ELDIWDRKNGDPVITHGPPLVTMVPEIPIRDVLEAIADSAFKTSLYPVILSLEIRCSLKN
QQKVAEICKEIFGDRLLMEPLSSNKIEAGVPLPSPNALQGKILIKCRRSVADGKGSIGRR
SKANATSVDRDFILSASTLTLNKIGNLSRTQLSVDDDKSTESAVSNTESISDDEESEDYT
FGTGKPKKNLEVSEELSALVNYMKATKFKSFEDSASRNFSNEVTSFSEVKGYEMMQKDVT
SFINYNKHRCTRIYPRGNRMNSSNYAPQIFWSVGCQLVALNFQTLDTPPMQINLGKFEMN
GRSGYLLKPKCMREFGKTFDPLEEGAIENVVTNSVTIQIISGQLLSLSKINTFVEVEMCG
IPSDCVRKRYRTKLVENNGINPVYLDADTKPFEFQKVILPEAASVRFVVFEYSNRATFLG
HSMIPVVGLRPGYRHIGLKSAMNKPLSMATLFVHIKVTDFVPVIHLAFADALSNPIQYSK
AAINRESLLKKMIEDEEMESFNGGVSNVFEEAKRKNCMPVLSKMIPSPVLERSRSSGAII
LKHLTKMLADLPTSSDRKFDFSTPLPSLLLKSYTIQTPTEDMLKANAKYVKLRKKFGKDL
ENLQSKHAKERSALQKKTNKGEGDIQSSFSRQVDVSTLQKAFACIPRKLSTGSQESHFVS
RSSGASNETLADSKCPNLTPMEMLCSKHWKQQWLLMKNMEIALFDQLMKLVGHSCKMNIQ
MLNVIYERTVEDSMNALQEKRKMEMENLIQSIGSSNSNVDGRLGKLKRETEERFIKNGVE
LRKRLESIRASRADEIVNSHDELKRNCIKQFETFHHFNLKRMANLQTEYEEKISTVGKQA
AAKQHRSAMNVNLFVQTALLTNSVCKCYQHFEQSFGVSATQYHQNIHHYDNILFI
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atgtggaataaaaatcagaaagggctacgggatgaatgggctaattctggatattttgga
cagcagacatgggaaaagcgcaaaagtaataaaggtatgcgcatattgtatggtatgata
aaacataccgtgcattcaagtgtatttgttgctggttcagattgcagttgcatgataacg
atttttatacataattacgatgttgaaagccgtatcgatgttaaattacatatttcacgc
gtagaaatggaaaaatggaaaaatcacaaagctgttttgtcacttttgaatacgaattca
tcttttgaagactgtttattaacaattgttactggcgacacgttcatcgatcttcgattt
cacatttttctcgcttcatcttcacaatctgctcagaattgggctgaagaattgtttcgc
cgagctagcaatgtattgtttcgtaatggctgcgttttggattatttgaacgttgcatat
gcgaaaatgcgttattgttttggcacgaatgaaattcctactaaagatgtattgaattta
tttgctttaaacaaagatgatcgtaagattgttgaaaaagctatggtggacagtggatta
ttggaaaacatcaatttgacggttatgaagatggatgatttgagcaaagagcgttgcgct
gaagtgaaaggaaatctgactagccaagacgagcaggtgatgtctacgttgaatgataga
gaattttgtgcctttctaaataggcatcaacgtgatccaagattgaacgaacttttgttt
cctccttttacattggaaaatgcacggacgttgatcgaaaaatatgaaatcaagaagaat
cttaaatcaaccagacgtttgtcatttatgggatttttacattttctactcagtgaagat
agtctgccatgtaatgaagattgtttagttgttcaagagaagcaaatgaacgagccactt
gcgcattacatgatcaacagttcacataatacttatttaacaggtccgcaagttggtctt
caagctaaatgcagtgctgaaatgtataggcaagttttgatttccggctgcagatgcgtg
gaattggacatatgggatcgaaaaaacggagatcctgtaataactcatggtcccccgttg
gttacaatggttccagaaataccgataagggatgtactggaagctattgccgactctgct
tttaagacatctttgtatcccgttattctttctttggaaattcgatgcagtttgaaaaat
caacaaaaagttgctgaaatttgtaaggagatttttggagatcgactgctaatggaacca
ctttcaagtaataagattgaagcaggtgttccgttgccttcaccgaatgctcttcaaggg
aagatattgattaaatgtcgacgaagtgttgcagatggaaaaggaagcattggtcgtcga
agtaaagctaatgctaccagtgtcgaccgagattttatattatcagcaagcaccttgaca
ctgaacaaaattggcaatttatcacgtacacaacttagtgttgatgatgacaaatcaacc
gaaagtgcagtatccaacacggaatcaatatctgatgatgaggagagtgaagactacact
tttggaaccggtaaaccaaagaaaaatttagaggtatctgaagaattatcagcgttagta
aattacatgaaagcaacgaaatttaaatcgtttgaagacagtgctagcagaaattttagc
aatgaggttacttcgttttcagaggtgaaaggatacgaaatgatgcaaaaagatgttact
agctttataaattacaacaagcatcgttgtacacgaatctatccacgtggaaataggatg
aactctagcaattatgccccgcaaatattttggagtgttggttgccagttggttgctctt
aattttcaaactttggatacacctccaatgcaaataaacttgggaaaattcgaaatgaac
ggtcgtagtggatatctgttgaagccgaaatgtatgcgtgaatttggaaaaacatttgat
ccattggaagagggtgccattgaaaatgttgttacaaattcagtaactatccaaataata
tctggtcagttgttgtctttatccaagataaatacttttgttgaagtagaaatgtgtgga
attccatctgattgcgtccgtaaacgatatcgcacaaagctggttgagaataatggaatc
aatcctgtttatttagatgctgatacgaagccttttgaatttcagaaggttatattacca
gaagctgcttccgttcgatttgttgttttcgaatacagcaatcgagctacatttcttgga
cacagtatgataccagttgtaggccttagaccaggatatcgtcatattggtctgaaatct
gcaatgaacaaacctctgtcaatggcaacgttatttgtacatatcaaagttactgacttt
gttcctgttattcatttggcttttgctgatgccctttcgaaccctattcaatattccaaa
gcagcgataaatcgagaatccctgttgaaaaagatgatcgaagatgaggaaatggaatct
ttcaatggtggtgtttcgaatgttttcgaagaagcgaaaagaaaaaactgcatgccggtt
ttgtccaaaatgattccaagccccgttttagaaagaagtcgctcatcaggggctattatt
ctgaaacacttgacaaaaatgttggctgatttgccgacatcctctgatcgaaaatttgac
ttttctacacccctacctagtcttctattaaaaagttatacaattcaaactcctacggaa
gacatgctcaaagctaatgcgaaatatgttaaacttcggaaaaagtttggaaaagattta
gagaatctgcagagcaagcatgctaaagaacggtcagcgttgcaaaagaagactaataaa
ggggaaggtgatattcagtcgtctttttctcgtcaagtagatgtgtctactttgcaaaaa
gctttcgcttgcattcccaggaaactttcaacgggttcccaagaatcacattttgtcagt
cgatcatctggtgcttcaaatgaaacactggcagattcgaaatgtccaaatttgactcct
atggagatgctgtgttcgaaacattggaagcagcagtggcttttgatgaagaatatggaa
attgctctgtttgatcaattgatgaaacttgtaggccattcttgcaaaatgaatattcaa
atgttgaatgttatatatgaaagaactgtggaagattcaatgaatgcactgcaggaaaag
cgtaaaatggaaatggaaaatttaattcagtcgatcggttcatcaaattccaatgtggat
ggccgattgggtaaactgaaacgagaaaccgaagaacgttttattaaaaatggcgtggaa
ttgcgtaaaagattggaatctattcgtgcatctcgtgctgatgaaattgtcaattcacat
gatgaattgaaaagaaattgcattaagcaatttgaaacgtttcatcacttcaatttaaaa
agaatggctaatttgcaaacagaatatgaagaaaaaatatccactgtcggaaagcaagca
gcagcaaagcaacaccgaagcgcaatgaacgtcaatttgtttgtacaaacagcattatta
acgaacagtgtctgcaaatgttatcagcactttgaacagagttttggtgtatctgcaaca
cagtatcaccagaacattcatcattacgacaatatattatttatataa

DBGET integrated database retrieval system