KEGG   Trichinella spiralis: Tsp_02523Help
Entry
Tsp_02523         CDS       T01609                                 

Definition
putative filamin/ABP280 repeat-containing domain protein
Orthology
K04437  
filamin
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_02523
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Tsp_02523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 782 aa AA seqDB search
MFMFSIYKNCFTRRIFYVVFFLRTTSGLSVKIEGPAKADVKCHDNKDGTCSITWIPPAPG
EYTVHIQYAGKTIEGSPFKATVSGEGRKRAQISVGSTSEVSIKVTDPDVSVLSASIKSPS
GVSFTPREPGEHLVTVKKRGKLIHGSPFCITVNKADVGDASKVKVTGAGTSQAITQEFNS
FQLDTRQAGYGGVSVSLEGPSRCEIKYEDNKDKTCKIFYKPFEPGLYVLNVKFADHHVPG
SPFTLHCEGKGVGTVTETIEQTVPASPCVMPGDDCHVSLKIPGSSAIDLTASVMNPEGVI
EDVELCEDSEEIYLIRFTPQMLGVHTLSVLRHGQHIAGSPFQYTVGPFQDSGTHKVHAGG
PGLISGEVNMPCFFSIYSREAGAGTLQIYIEGPSKAKLEYHEYRTGDGYISYCVTKPGDY
NVAIKFNEKHIPDSPFKVYISSPTGEARKLEVCSFPDSYGLAVNKPVTFTLVTHGAEGNL
DAKVFSPSGATDDCFITPIEEHGKKYCSVTYFFNSQNICIVLYNTESYAIRFVPKEIGNH
YLHITLDGIHMKDSPFRFRAGPKGEVDPIGVTVIGEGLRSGITGHKCEFTINTCHVGPGN
LQVQLDGPSKATLDAYDVEIGYKVRYTPLAPGDYFVTIKYNGIHIPGSPFKINVTGQHLG
GSGINESSKVNINTVSKSSEGAAMQVPKYYGDAALVVCQGAGLKKAFASRQNIFNVDCSR
AGQDLLFVCVMTQKGPAEETHIKHVGRGIFHINYMVRERGTCFVHVLYGNKHVPGSPFML
QI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgttcatgttttcaatctataaaaactgttttacacgacgcattttttatgtcgtgttt
tttctgagaacgacaagtggtttgtcagttaaaatcgaaggtccagccaaagcagatgta
aagtgccacgataataaagatggcacttgttcgattacttggattcctccagcacctgga
gaatatactgttcacattcagtacgctggaaagactatcgaaggatcacctttcaaagcg
actgtttctggagaaggaagaaaacgagcacaaatttctgttggttctacaagtgaagtg
tcgattaaagttaccgatccggacgttagtgtactgagtgcatctatcaaaagtccttcc
ggagtgtcgttcacgccacgtgaaccaggagaacacttggtaaccgtgaagaagcgtggc
aaattgattcacggctcaccgttttgtataacggtcaataaagctgatgttggcgacgcc
agtaaagtgaaagtgactggtgcaggaactagccaagcaattactcaagagtttaattct
ttccagttggatactcgtcaagctggatatggaggtgtgagcgtttctttggaaggcccg
tctaggtgtgaaatcaaatatgaagacaataaagataaaacgtgcaaaatattttataaa
ccatttgaacctggcttgtatgtgttgaatgtgaaatttgctgatcaccacgtaccaggt
agtccattcactttgcattgtgaaggcaaaggtgttggtacagtcactgaaacaattgaa
caaacagtcccagcatcaccttgtgtaatgccaggcgatgattgtcatgtatcgctgaaa
attccaggatcttcggcgattgatctaaccgcaagcgtcatgaatcctgaaggtgtaatt
gaagacgttgaactttgtgaagattcagaagaaatctatttgattcgattcacgccgcaa
atgttgggcgtgcacacgttgtccgtactgagacatggacagcatatcgctggtagtcca
ttccagtacacggtgggtccgttccaagatagtggaacccacaaagtgcatgccggtgga
cctggactcattagtggtgaagtgaatatgccgtgctttttcagcatctactctagagaa
gcgggtgctgggacgttgcaaatttacatcgaaggaccatcaaaagcaaagctagaatac
cacgaatatagaaccggcgatggttacatttcttactgtgtgactaaaccaggagattac
aatgtggcaatcaaatttaatgaaaaacacataccggacagtccttttaaagtgtacatt
tcgtcgccaacgggcgaggcgaggaaacttgaggtttgctcttttcctgactcttacggc
ttagctgtgaacaagccagttactttcaccctggtcacacacggcgctgaaggaaacctc
gatgccaaagtattttcaccttctggtgcaactgacgactgcttcatcactccaattgaa
gaacatggtaaaaaatattgcagtgttacgtatttttttaattcacaaaatatttgcatt
gttttgtacaatacagagtcgtacgcgataagatttgttccgaaagagatcggtaatcat
tatctgcacattacactcgatggtattcacatgaaagattcacctttccgatttcgagct
ggaccgaaaggtgaagtcgacccgatcggtgttaccgtaattggtgaaggtttaagatct
ggcatcactggacataaatgtgaatttactatcaacacatgtcacgtcggaccaggaaat
ttacaagttcaattagatggaccgagcaaagcaactctcgatgcatacgacgtggaaatt
ggctacaaagtacgctacacgccattagcgcctggtgactatttcgtaaccatcaagtac
aacggaattcatattcctggatcaccgttcaagattaatgtcaccggccagcatctgggt
ggaagtggcataaacgaatcttctaaagtgaacatcaatactgtgtcgaaatcaagcgaa
ggtgccgcaatgcaagtgccgaaatattatggtgatgctgcgctagtagtttgccaagga
gccggcttgaaaaaggcatttgcaagtcgccagaatattttcaacgtcgattgctcacga
gcaggacaagatttgctctttgtttgcgttatgacgcagaaaggacctgccgaagagacg
cacatcaaacacgtaggacgtggcattttccacattaactatatggtacgtgaacgtggc
acttgcttcgttcacgtactttatggcaataagcatgttcctggtagtccatttatgctt
caaatttga

DBGET integrated database retrieval system