KEGG   Trichinella spiralis: Tsp_02535Help
Entry
Tsp_02535         CDS       T01609                                 

Definition
cGMP-dependent protein kinase, isozyme 1
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tsp  Trichinella spiralis
Module
cGMP signaling
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Tsp_02535
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Tsp_02535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 719 aa AA seqDB search
MDQSHFMRFIVQLRMRQTAFSFGFESRRIAHVEEQIQRRTEGTAPDASKYGRPGGKCEEA
GRLGRTEHLQRQSVTDPLQEESKQLIRNAILQNDFLRHLDREQVSEMVECMYERDVPENE
FVICEGAAGAHLYVAAQGELQVFKNEKMLGKMGPGKVFGELALLYNCTRTASVKAMGPVK
LWVLDRAVFQMITMRLGLQRHETLMNFLRDVPLFKNLSEDRISKLADSMDLDYFTEGTYI
IREGEKGDLFYIITSGTVRVTQLIDGKDEPQEIRKLQKGDFFGEKALLGDEVRTASIIAV
DSVEVLTLDRESFQKLIGDLEELKRDYGDEQRGAKRLVDKRISSSDGTIDRFPSTPTKVE
YDNEIAALELTHMQPIATLGVGGFGRVDLVFLIQNPTRTFALKTMKKKHIVDTRQQEHIF
NERNLMFEFRSPYIVRLHKTFRDKKYVYMLLEACLGGEVWTILRDRGHFDDLTARFYVAC
VIEGLEYLHRKMVIYRDLKPENCLLDATGHLKIVDFGFAKRLPSGRKTWTFCGTPEYVAP
EIILNKGHDHSADFWALGIFICELLMGRPPFQASDPMKTYTLILKGVDALDIPNRRIGKT
ATSLVKKLCRDNPAERLGCQSGGYDDLRKHRWFAGFDWEGLRSRSLPPPIIPKINGPTDI
SNFDHYPADYDVPPDELSGWDEGNGSFPILIKMKKIASAQVSETWPDFAECQLSLGCLT
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatctcatttcatgcgttttattgttcaactcagaatgcgacaaactgcgttc
agttttggatttgaaagtcggcgaatcgcccacgtcgaggagcaaatccagcgacgaact
gagggcacagctccagatgcaagcaagtatggtcggccaggcggcaaatgtgaagaagca
gggcgtctcggccgaaccgaacacttacaaagacaaagtgtcactgatccattacaagaa
gagtccaagcagttgataagaaatgcaattttgcaaaatgacttcttgaggcatttggat
cgtgagcaagtttcagaaatggtcgagtgcatgtacgaacgggatgtaccggagaatgag
tttgtcatttgcgaaggagcagccggtgctcatctctacgttgcagcacaaggtgaatta
caagtattcaaaaatgaaaagatgctcgggaaaatgggtcctggcaaagtattcggcgaa
cttgctttgctttacaactgtactcgtactgcatccgtgaaagccatgggaccggtgaaa
ctttgggtattggatagagcagtttttcaaatgatcaccatgcgtcttggattgcaaagg
cacgaaacgttgatgaatttcctacgcgacgtgccactgttcaaaaatttatccgaagac
cgaatcagcaaacttgccgactctatggatttggattatttcaccgaaggaacatatatt
atacgtgaaggtgagaaaggggatctcttttacatcatcacatccggaacggttcgtgtt
acgcagcttattgatggcaaagatgaacctcaagaaattcgaaaattgcaaaaaggtgat
ttttttggagaaaaagcattgctgggtgatgaagtacgtactgcttcgattatagctgtt
gattcagttgaagttttaacgttggatcgagaatcttttcaaaaattgatcggtgattta
gaagaattgaaacgtgattacggtgacgaacaacgaggtgctaaaagattggtcgataaa
cgaatttctagcagtgacggaactatcgatcgttttccttcaactcctaccaaagttgaa
tatgacaatgaaattgctgcgttggaattgactcatatgcaaccaattgcaactttggga
gttggtggttttggccgtgtcgatttggtatttttgatacaaaatccgactagaacgttc
gctttgaaaacgatgaaaaaaaagcatattgttgacactcgccagcaagagcacattttc
aacgaacgtaatttgatgtttgaatttcgttcaccatatattgtaaggttgcacaaaacg
tttcgtgataagaaatatgtgtacatgctgttggaagcttgccttggtggagaagtatgg
acaattttgagagacaggggtcattttgacgatttgacagccagattttatgttgcctgt
gttattgaaggtttggaataccttcatagaaagatggtcatttatcgtgatttgaaacct
gaaaattgtttattagatgctactggtcatttgaaaattgtggactttggttttgccaaa
agactgcctagtgggcgaaaaacgtggacattctgcggtacgccggaatatgttgctccg
gagatcattcttaacaagggtcatgatcattcggcagatttttgggctctgggaattttt
atttgtgaattgctcatgggacgaccaccttttcaagcttcggatccaatgaaaacgtac
actttgatattgaaaggggtcgatgcgttggatattcctaatcgtcgtattggtaaaacg
gctaccagtttggtgaaaaaactttgtcgtgataatccagccgaaagactcggctgtcaa
tccggtggatatgatgatcttcgcaagcacaggtggtttgccggatttgattgggaagga
cttcgcagtcgttcgttaccacctccaattatacccaaaatcaacggtcctacggatatt
agcaatttcgatcattatccagccgattatgatgtgccaccggatgaactttccggctgg
gatgaaggcaacggttcttttccaatacttattaagatgaaaaaaattgcatctgcacaa
gtgtctgaaacttggccagacttcgctgaatgccaattgtcacttggttgccttacatga

DBGET integrated database retrieval system