KEGG   Trichinella spiralis: Tsp_02642Help
Entry
Tsp_02642         CDS       T01609                                 

Definition
putative cyclic nucleotide-binding domain protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tsp  Trichinella spiralis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tsp00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1316 aa AA seqDB search
MVSGLYWVLVEILTKDGCIHAIHSAALRVLECQSKTKFKDSAVDLHNFKLCKYFHLSQFL
NSRCIEGANHYPTMKHFKNLKIITIGMGCIFITWVINRFMRLNVATSSATKYPVTFSRKS
SFNYRFRKRDRMLFYGRKLMRKVTSAVINGDKKQKLRKRDRVFRFASKFLRPQKKDFTAR
PIRRPPDAFLEADTSLPVSPKSVQLLNMLKSIRILGHFEIPFFLDVCKHIETKRFAADQF
VFKDGEIHDCIYIVESGRLSLFIKDEKFDFEVKSVGRGDSLYCSLSILDMIKNQARPMKN
VFAKATEESVVLQLKSSVFNDIFDKYPESWTRTVQIILLRFQRITLATLYRYFGFTSELS
KTGSRTVSKLSPLQEQSCKDFREIKSENEGATPEDCTASENAFPTFGVSTTDDDSDIFQV
AIEELAKLFGMKEASFLVDKVKVEKFEPGIMIVRQGSNVHCQYRCSCCCVYELQLFYVVS
GMLELLLESQEEPDVLLPISIVQTGDVIGGLSVLTGEPSFFAVRTRSFCQLAIVERKSLY
ECVTFLNRIISEYPRVVVNVASTAVESYSDFVKEFDMAVEWEICESGKALYKLQNEQADA
LYVVLSGRLRSVLTREPGTREVLNEHGRGDVVGLVEIWTLRRRSTSVIAIRDTELCKIYA
TLMNFIKNKHPQVLSNIIRLLGHCIIEQQQQTVSAVHREPLAHVSNLNTIAVLAVSDEVP
LTGFTVELWNALNSITPTELFSSYTLQDMLGPTALDKVNEYQIITWLNQQEDGNSIVLYQ
CDVELTTFTSLCIRRADCILIVANGEQEPMVGEIEKELENLTVRAQKELILLWHDSTDRP
RRTAEWLDLHGWVSSHYHVRFRDRVFKQRNPKRMLRYKERIIRRCDNRHTDIARLARALT
STSIGIVFGGGGARGAAHVGIIKALKDHGIPVDIVAGVSIGAFVGGMYCLDSDVPKLIMC
AKQAFKEAASFWARLFDLTYPVSALFTGKALNRLLKSVFNDVEIEDLWIPYFNVTTDITS
SEMRVHRSGKLWRFTRASMSYIGILPPLCDPIDGHYLVDGCYMNNLPGTLWRYCRASMSL
AGFVPPIFDLTDEHLLLDGGYVNNLPADVMRSLGVRTVIAVDVGALTETEFTNYGDSLSG
WWALWKKYNPWASPVRVMSMAEIQSRLAYVSCVRQLEEVKKAPYCHYVRPPIDKYQTSSS
ELCSPIQNVGYWHGKTLLEEWKSSGKLQEVFDGRSANLSKFAQREKFKRGFAFTSAQSFT
DLAAMVSKIHRPFETSLDESKSLYILYFHSVSEEEGDDRIPLDLIHPTSSSSAKLA
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtggattgtactgggtcctggtagaaattttgacaaaggatggatgcattcat
gcaattcattcagctgctttacgagtattggaatgtcaaagcaaaactaaattcaaagat
tcagctgtcgatttgcataactttaagctttgcaaatattttcatctatcgcagtttttg
aattcgcggtgcattgaaggtgccaaccactatccaacgatgaagcactttaagaatttg
aagatcatcaccattggaatgggttgcatatttattacttgggtaataaataggtttatg
cgattgaatgtagcaacatcatctgctacaaaatatccggtgacttttagtcggaaatcg
tctttcaattatcgctttcgaaagcgtgaccgaatgctattttatggacgtaaattgatg
agaaaggtaacaagtgccgtgattaatggtgataaaaagcaaaagttgagaaagcgggat
cgcgttttcagatttgcttccaaatttcttcgtccgcagaagaaggactttactgctaga
ccaattcgacgaccgccggatgcttttttggaagctgacacttcattgccagtgtcgcca
aaatcagtacagctgctgaatatgttgaaaagcattcgaattcttggtcattttgaaatt
ccattttttctcgacgtttgcaagcatattgaaacgaaacgctttgctgctgatcagttt
gttttcaaagatggagaaattcacgactgcatatacattgttgaaagcggtcgtctttct
ttatttatcaaggatgagaaattcgattttgaagtgaaatccgtgggcagaggagatagt
ttgtattgttctttgagtattctagatatgatcaagaatcaagccagacccatgaagaat
gtttttgcaaaagcgacagaagaatctgttgttttacaattaaaatcgagcgtattcaat
gatatttttgataaatatccagaatcttggacacgtaccgttcaaattattcttctccgt
tttcaacgtataacgctagccacgctttatcgttactttggtttcacgtcagaattgtcc
aaaactggtagtcgtacagtgtcaaagttatccccattgcaagaacagtcttgtaaagat
tttcgggaaattaaatcagagaatgaaggcgctactcctgaagattgtacggcatctgaa
aatgcttttcctacctttggggtgtctactactgatgatgattcagatatttttcaagtg
gccattgaagaattagccaaattgttcggcatgaaggaggcatcattccttgttgacaag
gtgaaagtggaaaaatttgaacctggcataatgatagtcagacaaggctcaaacgtacat
tgccaatatcgttgtagttgttgctgtgtgtatgaattgcagcttttctatgtggtatcc
ggtatgttggaattgttgctcgaaagtcaagaggagccggatgttttgttgccgatttcg
atagtgcaaacgggtgatgtgattggcggtttgtcagttttgactggtgagccatctttt
tttgcggttcgaactcgcagcttttgtcagcttgccattgtggaacgaaaaagcttatac
gagtgcgttacttttctcaatagaattatcagtgaatatccaagggtagtggtcaacgtt
gcctcgactgcggtggaatcttactctgattttgtaaaagaattcgatatggccgtcgag
tgggaaatttgtgaatctgggaaagctctttacaagttgcaaaacgaacaagctgatgct
ttatacgtggtgctcagtggaagattgcgatccgttttgaccagagaacctggtacgaga
gaggtgctgaatgaacacggtagaggtgatgtagttggattggttgaaatttggactcta
cgccgtcgttctacgtcagtgattgccattcgggatactgaactttgtaaaatatacgct
acgttgatgaatttcatcaaaaacaaacatcctcaagtgttgtcgaatataattcgttta
cttgggcattgtattattgaacaacaacaacagacagtatcggcagtacatcgtgaaccg
ttggcccacgtatcgaatttgaatacaattgccgtccttgccgtctctgatgaggttcct
ttgaccggctttacggtggaactttggaatgcgttgaactcaataacaccaactgaactg
ttctcttcttatacactgcaagatatgctcggtcccactgctcttgacaaggttaacgaa
tatcaaataattacctggcttaatcagcaagaggatggtaatagtatcgtactttatcag
tgtgatgttgagttgaccacatttacatcactttgtatcaggcgtgccgattgcatattg
attgttgctaacggtgaacaggagccaatggttggcgagattgaaaaagagttggaaaat
ttaaccgtacgagcgcaaaaggagttgattcttctttggcacgattctacagatcgacct
cgtcgtactgccgaatggcttgatcttcatggctgggtttcatcacattatcatgttcgc
tttcgtgatcgggtgttcaagcagcgtaatccaaaaaggatgttgcgctacaaggaacga
atcatccgccgatgtgataacaggcatacggacattgcgaggctagcccgggcgttgacg
tctacttcaattggtattgttttcgggggagggggagcaagaggtgctgctcacgtgggt
attattaaagcgttgaaagatcacggcatcccggtggatattgtggctggtgttagtatt
ggtgcttttgttggtggcatgtattgtcttgactcggatgtaccaaagttgatcatgtgc
gccaagcaagcgttcaaagaagctgcgtcgttttgggcgaggttgtttgatctcacgtat
ccagtatcagctctgtttacgggcaaggcgttgaatcgtttgttgaaatcagtattcaac
gacgtcgaaattgaagatctttggattccatacttcaacgtgaccactgacatcacatca
tcagagatgcgtgtccatcgaagtggtaaactgtggcgcttcacacgcgccagtatgtcc
tacattggtatattgccgcctctgtgcgatccaattgatggtcattatttggtcgacggt
tgttacatgaacaatttaccaggcacgctgtggcgttactgcagggctagcatgtcgctg
gccggtttcgttccacccatttttgatctcactgacgaacacttgctccttgacggcggc
tatgtaaataatttgccagctgatgtgatgcgcagtttgggtgtgcgaacggtgattgca
gtggacgtgggggcactgacggaaactgaatttaccaactacggcgattctttgtctggt
tggtgggctttgtggaaaaaatataatccctgggcatcgcctgttcgggtaatgagcatg
gctgagattcagtcacgtcttgcgtacgttagctgtgtgagacagttggaagaggtgaaa
aaagcaccttattgtcattacgttcgtccgccaatagataaataccaaaccagctcatcg
gaattgtgttctccaattcagaatgttggatactggcatggcaaaactctgttagaagaa
tggaagtccagtggcaaattgcaagaagtgtttgacggacgatcggctaatctttccaaa
tttgctcagagagaaaaattcaagcgagggtttgcattcacgtccgctcaatcattcaca
gatcttgctgctatggtatcaaaaatacatcgtccctttgaaacatctctagacgagagt
aagtccttgtacatattatattttcattcagtttctgaagaagaaggtgacgatagaatt
ccgcttgatttgattcaccctaccagtagttcatccgcaaaattggcttaa

DBGET integrated database retrieval system