KEGG   Trichinella spiralis: Tsp_02907Help
Entry
Tsp_02907         CDS       T01609                                 

Definition
putative glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tsp  Trichinella spiralis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tsp00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tsp00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tsp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 553 aa AA seqDB search
MWNQLTHFVLLKFLTIFFIANKVTSEFECKKKDFGHGSPVCICDESYCDKVKPIPEITSD
QVIIYLSSKSGDRLQQSVAHFSNDIKTKLDDLLITIDLNLSKQSIIGFGGAFTDSTGMNI
AQLSEKVQNDLMDSYFSRDGNLRINAHVIKPLSCFSGIEYNIGRVPIASCDFSSRVYSYD
DVDSDFQLQNFTLTEEDFHYKIPFIKIAQEKTSNKLKLFGSPWSAPAWMKTNKKMAGKGT
IIGKPGNKYYETWAKYFVRFLEEYKKHDIDFWALTMQNEPTTGFIVNYPFQTTGFTPAMQ
RDFLKINLGPTLRQSAFNNTKIMILDDSRLLLPFWADVILRDPDAQQYVSYIAVHWYSDR
YTPACKLNITHARFPDFPLIGTEACNGFAFWQTRGPILGSWYRAQQYAHSIIEDLNNYFT
GWVDWNLALDMEGGPNWANNTVDSPVIVDKENNAFYKQPMFYILGHFSKFFIPDSVVLHT
EVQKRYAMETGVEATAALRPDGIVTLVLHNSMMKSVPVKIVQKNDTRSLCLDLPPHSIQT
VLWLRAEEIINNV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaccaactgacgcatttcgtactgctgaaattccttactattttctttatagca
aataaagtgactagcgaatttgaatgcaaaaagaaagattttggtcatggctcgccggtt
tgcatatgtgatgaatcatactgtgataaagtgaaaccaattcctgagatcacttcagat
caagtgatcatatacctctctagtaaaagtggcgaccgactgcaacaaagtgttgctcat
ttcagtaatgatataaaaactaaactcgacgatttattgatcacaatcgatttaaactta
agcaagcaaagtataattggatttggtggcgcttttacggattccactggcatgaacatt
gcacagctatcagaaaaagtacaaaatgatttgatggattcatatttcagtcgagatggt
aatctgagaataaatgcacacgtgataaaaccattaagctgcttttcaggaattgaatat
aatatcgggagagtgccaatagctagctgtgatttctcttcacgtgtgtattcatatgat
gacgtggatagtgactttcaattgcaaaacttcacacttacggaagaggattttcattac
aagatcccttttataaaaattgcacaagaaaagacctcgaataaattgaaattattcggt
agtccttggtcagcgccagcttggatgaaaacaaacaaaaaaatggccggaaaaggaact
ataataggaaaacctggtaacaaatattatgaaacgtgggcaaaatattttgttagattt
ctagaggaatataaaaagcacgacattgatttttgggcactgacgatgcaaaatgaacca
accactggtttcattgttaattacccatttcaaacaacaggattcacaccagcaatgcaa
cgagattttttaaaaataaatctcggaccaacacttcgtcagtcagcgttcaacaacacg
aaaattatgattctagatgacagtcgtctgttacttccattttgggcagatgtgatttta
agggatccagatgctcagcagtacgtctcttacattgccgttcactggtattcagacaga
tacacacccgcttgcaaattgaacataacacatgcccgttttcctgacttcccattaatt
ggcaccgaagcatgcaatggctttgcattttggcaaaccagagggcctatactgggtagc
tggtatcgtgcacaacagtatgcacattctatcattgaagatttgaacaactactttaca
ggatgggtagactggaacctagccctggatatggaagggggtccgaattgggccaataac
actgtagacagtccagtaattgtagacaaagaaaataacgcattttacaagcaacctatg
ttctacattttgggtcatttcagcaaattctttataccagattcagttgttctgcatact
gaagtgcaaaaacggtacgcgatggaaactggcgttgaagcgacagctgctttgaggcca
gatggcatagtcactcttgtactgcataacagtatgatgaaatcagttccagtgaaaatt
gtacaaaaaaatgatactcgaagcttatgcttagatcttcctcctcatagcatacaaaca
gttctttggcttcgtgcagaagaaatcataaataatgtctga

DBGET integrated database retrieval system