KEGG   Trichinella spiralis: Tsp_03058aHelp
Entry
Tsp_03058a        CDS       T01609                                 

Definition
neuroendocrine convertase 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Tsp_03058a
Peptidases [BR:tsp01002]
 Serine Peptidases
  Family S8: subtilisin family
   Tsp_03058a
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 610 aa AA seqDB search
MRLFFSFQLFLFCAHPPWIAKGAGAGNAFYTNSFHVHLHSGGQEAAHRLAKRHGFINVGP
VLRSSNEWHFIQPSLPNIRKKRSIFHHRKLARDPEVRHVVQQVGFKRAKRGFRNFEQKSA
QSEDLFPPMESPTDPLYPYQWYLKNTGQWGGKPNLDLNVEKAWALGYTGKNVTTAIMDDG
VDYMHPDLKDNFNVAASYDFSGNDPYPYPRYTDDWFNSHGTRCAGEIAAIRGNGVCGVGV
AYNSKIAGIRMLDQPYMTDLIEANSMSHEPNLIDIYSASWGPTDDGRTVDGPRNATMRAI
VKGVNEGRHGLGNIFVWASGDGGEDDDCNCDGYASSMWTISINSAINNGENAHYDESCSS
TLASTFSNGGKNRETGVTTTDLYGQCTKSHSGTSAAAPEAAGVFALALEANPKLTWRDLQ
HLTVLTSNRNSLFDGRCREIVDLRIPGVRKMHRSSRDNCSHFEWQVNGVGLEFNHLFGFG
VLDAAEMVILAKAWQTVPARFHCDAGSIWEPHRIPSSGTLVLEIDTNACRGTETEVNYLE
HVQAVVSLNSTRRGDVTLYLISPAGTQSMILSRRPKDDDHTDGFTNWPFMTTHTWGEGSS
GTWRLVVRFQ
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttatttttctcattccaattgttcctgttctgcgcacacccgccctggattgcc
aagggcgccggcgccggcaacgctttctacaccaattcctttcatgtccatcttcacagc
ggtggtcaagaggccgctcatcgactcgctaaacggcacggcttcatcaacgttggaccg
gtactgagatcttcaaatgaatggcactttatccaaccgtctttgcctaacattcggaag
aagcgaagtatttttcatcatcggaagcttgctcgagatccggaagtacgtcatgttgtt
caacaagtgggctttaaacgtgcgaagcgaggattcagaaattttgaacagaaaagtgcg
cagtcggaagatctctttcctccaatggaaagtcccactgatccattgtacccataccag
tggtatttgaaaaacacaggtcaatggggcggaaagccgaatctcgatctgaacgtagaa
aaagcatgggcgttgggttatactggaaagaacgtgaccacagctataatggatgacggg
gttgattacatgcatccagatttaaaagacaactttaatgtagccgctagttatgatttc
agtgggaatgatccgtatccttatccacgttatactgacgattggtttaacagtcatggc
acccgttgcgcaggggaaattgccgccatccgtggaaatggggtttgtggtgttggagta
gcgtataattctaaaatagccggcattcgaatgttggatcaaccgtacatgacagatttg
attgaagcgaattcaatgagtcacgagccaaatttgattgacatctattccgccagttgg
ggaccaacggatgatggtcgaactgttgatggtccacgcaacgccaccatgcgtgccatt
gttaaaggcgtgaatgaaggtcggcacggtttgggtaatatttttgtttgggcatctggc
gatggtggcgaagacgacgattgcaattgcgacggctacgcatcaagcatgtggacaata
tccatcaattctgccattaataatggcgaaaatgcccactacgacgaaagttgcagctcc
acactggcatcgacttttagcaacggtggaaagaaccgtgaaactggcgtcaccaccacc
gatttatacggccaatgtactaaaagtcacagtgggacgtcggccgctgcaccggaagct
gcgggcgtgtttgctttagctttagaagcaaatccaaaattgacttggcgcgatttgcaa
catctcactgtacttacgtccaatcgaaattctttatttgatggtcgttgtcgagaaatt
gttgatttgcgcataccaggtgttcgtaaaatgcatcgttctagtcgggataactgcagt
cattttgaatggcaagtgaatggcgtgggattggaattcaatcatttgttcggttttggt
gttctggatgcagccgagatggtcatattggccaaagcgtggcagacggttccggctaga
ttccactgcgacgctggcagcatttgggaacctcatcgaattccatccagtggaactttg
gtgttggaaattgacacgaacgcgtgccgtggtacagaaactgaggtgaactatttggaa
cacgtccaggcagtggtcagtttgaacagcactcggcgtggtgacgtgacgttgtacttg
atcagcccggccggcacccagtcgatgatattgagccgtcgaccgaaagacgacgaccat
accgacggtttcaccaactggccgttcatgactacgcatacatggggagagggttcgtct
ggaacgtggcgtcttgtagttcgattccaa

DBGET integrated database retrieval system