KEGG   Trichinella spiralis: Tsp_03230Help
Entry
Tsp_03230         CDS       T01609                                 

Definition
retinoic acid receptor RXR-alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
tsp  Trichinella spiralis
Brite
Transcription factors [BR:tsp03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    Tsp_03230
Nuclear receptors [BR:tsp03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   Tsp_03230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 502 aa AA seqDB search
MKADIIKIQLGKRRSPSSNPNLMRLILAGLEPSNTQTSNTCLVDSTQDSLFRLDCALDAN
KQLSTFADSSLTLDSPVQQQPASFYFSSSDLDTVSTTTPPPSYETLTQPPNSMLITSTTP
TPTATNTTAAAATATTTTTTTTTPPPPTTSNTNNNNTNKQYPPSHPLALPKHVCNICGDR
ASGKHYGVYSCEGCKGFFKRTVRKDLTYTCRESRHCVIDKRQRNRCQYCRYQKCLIMGMK
REAVQEERQRLRGDRSENGEPESTSNCISDIPPDRVLEAELMADKILLGVPQDTVDAYFV
QLVRWARMIPHYCELSIEDQALLLKNGWNELILALMAYHSTHTKSMEMCMSSSTTTTTAA
ADSTTSVNSLESSEDNNYDVIFDRMIHELTYKLKDLQVDRTELGLLRTIVLFNPDITGLK
CGTVVESYREKAYNCLEEYCRQKNPNQPGRFAKLMLRLPSLRSIGLACYDSPCFMPPIPT
LTSLIQALKEQCYALHATVPQF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgatataataaaaatacaattaggcaaacgtcgatctccgtcatcaaatcca
aatctaatgcgcttaatattggctggtttagagccttcgaacacgcaaacatccaacacg
tgcctcgtcgattcaactcaagacagtctattccgtctcgactgtgcactggatgcgaac
aagcaactttcaacttttgccgattcatctttaacactcgacagtccagttcaacaacag
ccagcttcattttatttctcttcttctgacctcgacactgtctccaccaccacaccacca
ccttcatacgaaactctcactcaacctccgaattcaatgcttatcacatccaccacacct
actcctactgctactaacactaccgcagctgcagctacagctacaacaacaacaacaaca
acaacgacaccaccgccgccgacaacatccaacactaataataacaatacaaacaaacaa
tatccaccaagtcatccattggcgttaccaaaacacgtgtgcaacatctgcggtgacaga
gcatccggaaaacattacggtgtatacagttgtgaaggatgtaaaggatttttcaaacgt
acggtgagaaaagatttgacttacacttgccgagaaagccgtcattgtgtaattgataag
cgtcagcgtaaccgctgtcaatactgccgctatcaaaaatgcctgatcatgggaatgaaa
agagaagctgttcaagaagaacgtcaacgcttacgtggcgatcgttcagaaaatggtgaa
ccggaaagtactagcaattgcatatctgacattccacctgatcgcgtgcttgaagctgaa
cttatggctgataaaattctgctcggcgttccacaggatactgtggatgcgtactttgtt
cagctagtccgttgggcccgtatgattcctcattattgtgaattatcgattgaggatcaa
gcattattgttgaaaaatggctggaatgagctcatcttagcactaatggcttatcactct
acgcatacgaaatcgatggaaatgtgcatgtcgtcgtccacaacaaccacaactgctgcg
gccgattcgactacatcagtgaactcattggaatcgtcagaagataataattacgatgtg
atttttgatcgaatgattcacgaattgacatacaaattgaaagatttacaagtcgaccgg
acagagcttgggcttttacgtaccattgtacttttcaaccctgatataactggtctgaaa
tgtggtaccgtggtcgagtcatatcgagaaaaagcgtacaattgcttagaagaatactgc
agacaaaagaatcctaatcagccaggtcgatttgcaaaattgatgcttcgccttccatca
ctgcgttccattggtcttgcatgttatgattctccgtgctttatgccacccattccgaca
cttacctctctaattcaagcactcaaagaacaatgctatgctttacatgccactgtacct
caattttga

DBGET integrated database retrieval system