KEGG   Trichinella spiralis: Tsp_03463Help
Entry
Tsp_03463         CDS       T01609                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Calcium signaling pathway
Autophagy - animal
Longevity regulating pathway - multiple species
Wnt signaling pathway
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_03463
   04310 Wnt signaling pathway
    Tsp_03463
   04020 Calcium signaling pathway
    Tsp_03463
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Tsp_03463
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Tsp_03463
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Tsp_03463
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Tsp_03463
Messenger RNA biogenesis [BR:tsp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Tsp_03463
Chromosome [BR:tsp03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Tsp_03463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 361 aa AA seqDB search
MVTVKEFLEKAKEEFKQRWEAQSATRSVLGNLSLTYVMLAVHHLFHQTANLDDFDRLKTL
GTGSFGRVMLVRHKQTQQYFAMKILDKQKVVKLKQVEHTLNEKRILQSVSFPFLVNMEFA
FKDNSNLYMVLEFVNGGEMFSHLRRIGRFSEPHARFYAAQIVLAFEYLHSLDIIYRDLKP
ENLLIDSQGYVKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWAMGVLIY
EMDAGYPPFFADQPIQIYEKIVSGKIRFPSHFTNELKDLLKNLLQVDLTKRYGNLRNGVA
DIKNHKWFSSTDWIAVYQRKIEAPLVAKCRHPGDTSNFDEYEEEALHISPVDKCVKEFAD
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcaaagaatttctcgaaaaagccaaagaagaattcaaacaacgatgggaa
gcacagtctgcaacacgtagtgttcttggaaatctttcgctgacatacgtgatgcttgct
gttcatcatttgttccatcaaacggcaaatttggacgatttcgaccggttgaaaactttg
ggcaccggctcttttggtcgcgtgatgcttgtgaggcacaagcaaactcagcagtatttc
gctatgaaaattttggacaagcagaaagttgtcaaattgaaacaagtggaacacacgttg
aatgaaaagcgaattctgcaatcggtcagttttccatttcttgtcaatatggagttcgct
ttcaaggacaattccaatttgtacatggtgctggagtttgtcaacggtggtgagatgttc
tcccacttgcggcgtatagggcggttcagcgagcctcatgcccgattctacgcagctcag
attgtgttggcgttcgaatatttgcattccttggatataatatacagagatttgaaacct
gaaaatctgctgatcgacagtcaaggctatgtcaaaataactgactttggatttgccaaa
cgggtgaaaggtcggacgtggacactgtgcggcacacctgaatatcttgcaccagaaatt
atccttagcaaaggttacaacaaagcggttgattggtgggcaatgggtgttttgatatac
gagatggatgcagggtatccgcctttttttgctgatcagcctattcaaatttacgaaaaa
atagtatctggaaagattcgtttcccttcgcattttaccaatgaattgaaagatttgctc
aagaatctgctacaagtagacttgacaaaacgatacggcaatttgcgaaatggggtagct
gatataaaaaatcacaagtggttttctagcaccgattggattgccgtgtatcagcggaag
atcgaagctccacttgtagcaaagtgtcgacatccgggcgacactagcaattttgacgaa
tacgaagaagaagcgttgcacatttcaccggtggacaaatgtgtcaaagaatttgctgat
ttttga

DBGET integrated database retrieval system