KEGG   Trichinella spiralis: Tsp_03463Help
Entry
Tsp_03463         CDS       T01609                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta
Organism
tsp  Trichinella spiralis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 361 aa AA seqDB search
MVTVKEFLEKAKEEFKQRWEAQSATRSVLGNLSLTYVMLAVHHLFHQTANLDDFDRLKTL
GTGSFGRVMLVRHKQTQQYFAMKILDKQKVVKLKQVEHTLNEKRILQSVSFPFLVNMEFA
FKDNSNLYMVLEFVNGGEMFSHLRRIGRFSEPHARFYAAQIVLAFEYLHSLDIIYRDLKP
ENLLIDSQGYVKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWAMGVLIY
EMDAGYPPFFADQPIQIYEKIVSGKIRFPSHFTNELKDLLKNLLQVDLTKRYGNLRNGVA
DIKNHKWFSSTDWIAVYQRKIEAPLVAKCRHPGDTSNFDEYEEEALHISPVDKCVKEFAD
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggttacagtcaaagaatttctcgaaaaagccaaagaagaattcaaacaacgatgggaa
gcacagtctgcaacacgtagtgttcttggaaatctttcgctgacatacgtgatgcttgct
gttcatcatttgttccatcaaacggcaaatttggacgatttcgaccggttgaaaactttg
ggcaccggctcttttggtcgcgtgatgcttgtgaggcacaagcaaactcagcagtatttc
gctatgaaaattttggacaagcagaaagttgtcaaattgaaacaagtggaacacacgttg
aatgaaaagcgaattctgcaatcggtcagttttccatttcttgtcaatatggagttcgct
ttcaaggacaattccaatttgtacatggtgctggagtttgtcaacggtggtgagatgttc
tcccacttgcggcgtatagggcggttcagcgagcctcatgcccgattctacgcagctcag
attgtgttggcgttcgaatatttgcattccttggatataatatacagagatttgaaacct
gaaaatctgctgatcgacagtcaaggctatgtcaaaataactgactttggatttgccaaa
cgggtgaaaggtcggacgtggacactgtgcggcacacctgaatatcttgcaccagaaatt
atccttagcaaaggttacaacaaagcggttgattggtgggcaatgggtgttttgatatac
gagatggatgcagggtatccgcctttttttgctgatcagcctattcaaatttacgaaaaa
atagtatctggaaagattcgtttcccttcgcattttaccaatgaattgaaagatttgctc
aagaatctgctacaagtagacttgacaaaacgatacggcaatttgcgaaatggggtagct
gatataaaaaatcacaagtggttttctagcaccgattggattgccgtgtatcagcggaag
atcgaagctccacttgtagcaaagtgtcgacatccgggcgacactagcaattttgacgaa
tacgaagaagaagcgttgcacatttcaccggtggacaaatgtgtcaaagaatttgctgat
ttttga

DBGET integrated database retrieval system