KEGG   Trichinella spiralis: Tsp_03536Help
Entry
Tsp_03536         CDS       T01609                                 

Definition
calcium-binding protein p22
Orthology
K17610  
calcineurin B homologous protein 1
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 223 aa AA seqDB search
MQVVFRCFKNKNCHTMGNNSSMLRDEEIQEIQKETGFSRNQIVRLYSRFTSLDKSGSGSL
CVEDFLRIPELAINPLRDMIVNAFFFERLPTPWRASSLVQYCAFRYSEDEERVNFRHFMR
VLARFRPIKKNKPHPLNRRRDKLRFAFSMYDLNHDGFITKNELLEILNMMVGAHISADQL
DRIATRTITEADKDGDGMISFEEFCEAMEKTNIEQKMSIRFLH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtgttcaggtgttttaagaataaaaattgtcacacaatgggaaacaattca
tcaatgcttcgagatgaagaaattcaagagattcaaaaagagacgggattttctcgtaat
caaatagtccgtctttacagtcgattcacatctttggacaagagtggttcaggatctctg
tgtgttgaagatttcttacggatcccagaactggctatcaatccactccgtgatatgatt
gtgaatgcgttctttttcgaaaggttaccgacaccttggcgggcttcttctcttgtccaa
tattgtgctttccgttatagtgaagacgaagagcgagttaattttcgccactttatgcgc
gtattggcaagatttcgtccaatcaaaaagaacaaaccgcatccgttgaatcgtcggcgt
gataaattgcgattcgctttcagcatgtacgatttgaatcatgacggtttcattactaaa
aatgaactattggaaatattgaatatgatggttggagcgcatatcagtgctgatcaactc
gatcgaattgctacgagaacaattaccgaagctgacaaagacggcgatgggatgatctct
tttgaagaattttgcgaagcaatggaaaagacaaatattgaacagaaaatgtccataaga
tttcttcattga

DBGET integrated database retrieval system