KEGG   Trichinella spiralis: Tsp_03596Help
Entry
Tsp_03596         CDS       T01609                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
tsp  Trichinella spiralis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Tsp_03596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 108 aa AA seqDB search
MSQIPKGDPEKGKKLFVQRCAQCHTVEKGGGNKTGPNLNGIVGRKSGQVPNFDYTAANKN
KGVIWTREALFEYLLNPKAFIPGTKMIFAGLKKESDRADLIAYLEQNS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaataccgaaaggtgacccggaaaaaggtaaaaagctttttgttcaacgatgc
gctcaatgtcacacggtggagaaaggtggaggtaacaagactggacccaatttaaacggt
atcgttggtcgcaagagtggtcaagtgccgaatttcgactataccgctgccaataagaac
aaaggagtcatttggacccgtgaagctttgttcgaatatttgctaaacccaaaggctttt
attcctggtacaaaaatgatttttgccggtttgaaaaaagagagcgaccgtgccgactta
attgcctacttagagcagaattcgtga

DBGET integrated database retrieval system