KEGG   Trichinella spiralis: Tsp_03690Help
Entry
Tsp_03690         CDS       T01609                                 

Definition
putative PH domain protein
Orthology
K16172  
insulin receptor substrate 1
Organism
tsp  Trichinella spiralis
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Tsp_03690
   04150 mTOR signaling pathway
    Tsp_03690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 956 aa AA seqDB search
MGILRKGKRARKRFFVLHQDSYNGPARLECFDNEKRYRCHAAPKLSIPLKTCFNINKKVD
SKLKFCIAMYTIDDYLLLGCENELDQDAWLHTLLEVLMNTKMTEYVWQVKVLKNRGLTEK
VSKLAGLFRFCLNTCSVYFYKLNTDEEFFEFPLVYISNYGHQGNLFFLRVGRSAVTGPGE
LWMNTEDVVDAGSMHETMKIILEDNHEQRQRNMPIEPRGLRSDSQNSTRSNSISVTTTLP
PEALMHSDLRSRAISENEKTLQNLRSHLNYLQHRSHSGVSSKLEYLANLNCYSCGAPPSY
SRSASHSPSVLHNRSGYHGSALATSPVIGLSNDSFGSISNSSDFDHFANGLRYSHRQHVG
NPSLELISRSTIVEESSGGSGTDCVPFCKTSKGILELNDENSFRPARTLITHCVDVHSSP
DCVESFRRMTLDSGCVDPVSPRRAVTDSWRLEDIRPTIGPDLVTAVPPLRAYSCGSKPTV
RNYGSVKQPSWMRKLQHFSFNDERKRAHSFGNWKSASGSEDLVEIDFGAFPYGRSNSGSF
GSGDSLNRSRASSAGTASIYRQSWSPKIEQISEQELSPSAKLIQDLIFTRRCRPSLERLA
EYVPMSPPVANVNDDTVSGKGSTSMFSSAEGDHVDVNDVEEDDDETDIMRVTREKKGLGS
FRIRPVSDEITFSPDIDSSLDILQGVDRMMHSDISSFGRGNSAANATTVPLAAASLEQRL
RFQRPMSSCKWSAAPRCSIRRRHSIGDPCGSIYEELKRRKKERFFHSDMNFITKFPLSEC
CKSISLLKRIGRRSLPADFSFQFNVGTVVQRLFFLISMSAIHRALFLWSCIMAFVIIAVM
RLDGRISWHWSAVFTPLWILDLVALFYTLLSCVRQVHLLRACSLGFAQIASDGYCKRRNV
SFLLVILFKLCFLSLLSVKLEQQQHQHSAVGKFSTGESIKFWHVMLPFWASMRRNN
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgggcattctgagaaagggaaagcgtgctcggaaaaggttttttgtcctccaccaggac
agttacaatgggcctgccagattggaatgcttcgacaacgaaaaacgctaccgctgtcac
gctgctcctaagctgtccattccattgaaaacgtgctttaacatcaacaaaaaggtggac
agcaagttgaaattttgcattgccatgtatacaattgatgattatttgttgcttggttgc
gaaaatgagcttgatcaagatgcgtggttgcacacgttgctcgaggtgttgatgaacaca
aaaatgacggaatacgtctggcaggtgaaggtgttgaaaaatcgtggcttaactgaaaag
gtgtcgaaattagccggtcttttccgcttctgcttgaacacgtgctccgtatacttttac
aaactgaacacggacgaagaattttttgaatttccacttgtatacatttcaaattacggt
catcaggggaatttgttctttttgagggtcgggcgttcagctgtcactggtcctggtgag
ctttggatgaacacagaggatgttgttgatgctggtagtatgcatgaaactatgaaaata
attcttgaagacaatcatgaacaacgtcagcgtaacatgcccattgaacctcgcgggttg
agaagtgacagtcaaaattctaccaggtcaaattcaatttctgtaacgaccacccttcca
ccggaagcattgatgcacagcgatttgcgctctcgtgccatctctgaaaatgaaaagact
ttacagaacttgcgtagtcatctgaactacttgcagcatcgttctcattccggtgtgtct
tctaaactcgaatatctagcaaatttgaattgctattcttgtggtgcacccccgtcttat
tctcgatctgccagtcactcgccatccgtgttgcataatcgttctggctatcacggatca
gcactggccacaagcccagtaattggtttgtccaatgatagttttggaagcatttctaat
tcgagcgatttcgatcacttcgctaatggtctgaggtacagtcatcggcagcatgttgga
aacccttcattagaattgataagtcgttcgacaattgtcgaagaaagcagtggcggcagt
ggtaccgattgtgtaccgttttgcaaaacttccaaaggtattttggaattgaatgatgaa
aattcttttcgtcctgctcgtactttgataactcattgtgtggatgtgcattcgtctccg
gactgcgtcgaaagtttccgtcggatgacattggacagtggttgtgtagatccggtcagt
cctaggagagcagtaactgattcgtggcgattggaggatattcgaccgactattggtcct
gatcttgtaactgcggtacctccattgcgagcatattcttgtggttcaaaaccaacagtt
cgaaattatggcagtgttaagcagccatcttggatgagaaaattgcagcatttttcattc
aacgacgaacgaaaacgggcacattcttttggaaattggaaatctgccagcgggtctgag
gatctggtcgagattgactttggcgcgtttccatatggtcgaagcaatagcggttcgttt
ggttctggcgattctttgaatcgatcacgtgctagcagtgccggcacggccagcatttat
agacagtcttggtcaccgaaaattgagcaaattagcgaacaagaattgtcgccaagcgcg
aaattaattcaagacttgatattcactcgtcgctgcaggccgtcgctggagcgtctagca
gaatacgttcccatgtctcctcctgttgcaaatgtgaatgatgacacagtatcaggcaaa
gggtcgacttcgatgtttagttctgcggaaggtgatcacgtcgacgtcaatgatgtagaa
gaagatgatgacgagacggacatcatgagagtgaccagagagaagaaaggacttggttcg
ttcaggatcaggccagtcagcgatgagattactttttcgcccgacattgactcgtcactg
gatattctgcaaggtgtggacagaatgatgcattcggatatttcttcttttggcagagga
aattcggccgccaacgctacgactgttccgcttgcagcagcttctttggaacaacgtctg
cgtttccaaagaccgatgtcttcttgcaaatggtcggcggcaccacgttgttctattcgg
cgccggcattccatcggtgatccttgcggttcaatttatgaagagctgaaacgtaggaaa
aaagagcgatttttccattcggacatgaatttcatcaccaagttccccttgtccgagtgc
tgcaaatctatatcactgttgaaaagaatcggccgacggtcgctgcctgctgatttctct
ttccaattcaacgtaggaactgttgttcaacggctgtttttcctaatttccatgagtgct
attcaccgagcactttttctttggtcatgcataatggcatttgtgatcatagctgttatg
cgtttagatggccgcataagttggcattggtcagcggtattcacaccgttgtggattctc
gatttagttgcattgttctatactttgctcagttgtgtgcgtcaagttcaccttctacgc
gcctgttccttaggttttgcgcaaatcgccagcgatggatattgcaaacgcagaaatgta
tcctttctgttggtgattttgttcaagctctgcttcttgtcactgctgtctgtaaagctg
gaacagcagcaacatcaacactctgcagttggaaaattttccaccggggaatcaatcaaa
ttttggcacgtgatgctaccattttgggcttcaatgagacgaaataactga

DBGET integrated database retrieval system