KEGG   Trichinella spiralis: Tsp_03724Help
Entry
Tsp_03724         CDS       T01609                                 

Definition
putative PDZ domain protein
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
tsp  Trichinella spiralis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 317 aa AA seqDB search
MALPADAPRTRLCHLIKSSIDQEYGFNLHAEAGKGQYIGSVDYNSPADNAGLCRGDRIVA
VNGVYVADQPHKDVVAKIKEDPLQCRLTVIDEAGELWYRERNLTVPLEDEFEDNTVSEQK
PLPRLCTLVRSNVNQEYGFNLHADRGRGHFIGKVDIGSIAERAGLEQGQRIVGVNNTLIY
VSSSHKDVVRLIKQDPSGVQLLVASPSVDDWYRSNGVEFSFTETETWLPTVVTGEQRKDN
NNGYVTTEGDDHIDGKFKMEITKTTTPMTEPEQGKVSLEDVNDQQFGAESANGSSFSNHC
VSQESQSSRKLIFFSDI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgccagctgatgctccaagaacacgactttgccatttgataaagtctagtatt
gaccaagagtatgggttcaatttgcatgctgaagcaggcaaaggacaatacatcggcagt
gtagattacaatagtccggcagacaacgctggcttatgccgtggtgatcgtattgtagct
gtgaatggtgtttatgtggccgatcaaccgcacaaggatgttgtggccaaaatcaaagaa
gatccgttgcaatgtcggcttactgtcatcgatgaagctggagaactttggtatcgtgag
cgcaatttgactgtaccactggaagatgaattcgaagacaatactgtttcagaacagaaa
cctttgcccagactgtgcacgttagtacggtcgaatgttaatcaagagtatggtttcaat
ttgcatgccgataggggcagaggtcattttattggcaaagtggacatcggctcgattgcc
gaaagagccggtttggaacagggccagcgtattgtcggcgtcaacaacacgctcatctat
gtgtcatcgtcgcataaggatgttgtacgattgattaagcaggacccatccggcgtgcag
cttttggtcgcatcaccgtcagttgacgattggtatcgcagcaatggtgttgaattttct
ttcacagaaaccgaaacctggctgccaacggtggtcactggtgaacagcggaaggataat
aacaacggttatgtaaccactgaaggagatgatcatattgacggcaagttcaagatggaa
ataactaaaacgacgacgcccatgactgaaccagaacaaggaaaagtatcattggaagat
gtgaatgatcaacagtttggtgctgaatcagcaaacggaagttcctttagcaatcactgt
gtcagccaagagtcacagtcttcgcgtaagttaattttcttttctgatatttga

DBGET integrated database retrieval system