KEGG   Trichinella spiralis: Tsp_03785Help
Entry
Tsp_03785         CDS       T01609                                 

Definition
(RefSeq) acetylcholinesterase 1
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
tsp  Trichinella spiralis
Pathway
tsp00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tsp_03785
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     Tsp_03785
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tsp00537]
 Enzymes
  Tsp_03785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 AChE_tetra
Motif
Other DBs
NCBI-GeneID: 10910512
NCBI-ProteinID: XP_003374589
UniProt: E5SH59
Position
Unknown
AA seq 660 aa AA seqDB search
MTQIFKKNKKITTSDKLATTNRTSSVNQPPFSPLDQPRQSASSRIEEDEHVGEKYNGDQQ
TLSPIVRLHDGSPVRGRLTYSAAGKMVTEFLGIPFAEPPTGRRRFRPPISKKPWTEVFEA
TRQPRSCPQSRDNYFQNFAGAEMWNANTPLDEDCLHLNVWVAGHQINQRPRLLPVMVWVF
GGGFWSGTASLDVYDGKILSSEEDVVVVSMNYRVSLFGFLYLGLADAPGNAGLLDQLEAL
KWVHRNIAAFGGDPADVTLFGESAGAASVSLHLLSPLSSPYYKRAILQSGAATAPWALEN
ADVLIERALLLSEACQCNVTIRDRNPDLLALVRCLQQAPVSQLLQHEWVTYEFLDFPWTP
VVDHYFLTEQPKALLESGQFKKCELLLGSNHDESIYFIVYYVDKIFKRDEVFTKQEFLVD
DRLFEQAVYALLPQKYRKNPIVHRAILFEYTDFDRPATAQRRQQALDKMFGDYHFTCGVN
EFARRFRDHGSPVYSYYFTQRSSEQQWPEWMGVLHGYEINYVFGEPLNVKQFAYTEAEKD
LARRFMRYWANFARTGNPNVNPDGTWTPELWPKYSQDELYLILSASTNGTGHGPRRRQCT
FWSQYIPKLFAATASLSDVEMKWKIQMMKWEEEYIAEWKHHFEMYKKIQQHSYMDTYCRN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaattttcaagaagaacaagaaaattacaacaagcgacaaacttgcaacgaca
aaccgaacatctagcgtcaatcaaccgccgttcagcccgttggatcagccacgtcaaagt
gccagctctagaattgaagaagatgaacatgtgggtgaaaaatacaacggcgaccagcag
accctctcaccgattgttcgtctacacgacggcagtccagttcgtggtcgactgacatac
agtgcagctggtaagatggtgacggaatttctgggcataccgttcgctgaaccgccgaca
ggcaggcgacggtttcgaccaccgatcagcaaaaagccctggactgaggtgttcgaggcg
acacgtcaaccgcgttcgtgtccgcagagcagggataattattttcaaaattttgccggc
gctgaaatgtggaatgcgaacacaccgctcgacgaagactgcctgcacttgaacgtctgg
gtggccggacatcagatcaaccaaagaccacgactgcttccggtgatggtttgggtattt
ggaggcggtttttggtcgggcacggcgtcgttggacgtttacgatggaaaaatcctcagc
agcgaagaggatgtggtcgtcgtgtcgatgaactaccgggtctcgttgttcggctttctc
tacttgggcttggccgacgcgccgggcaatgctggcttgctggatcagttggaagctttg
aaatgggtccaccggaatatcgccgccttcggaggcgaccctgcagatgtgacacttttc
ggcgaaagtgctggcgccgcaagtgtcagcttgcatctgttgtcgccgctcagcagtcca
tattacaaacgagcaatactgcagagcggagctgccaccgcaccctgggctctggaaaat
gccgacgtgctcatcgaacgtgctttactgttgtccgaagcttgccaatgcaacgtgacc
atccgtgatcgcaacccggacctgctggctttggtccgatgcttgcaacaagcaccagtg
tcgcaactgttgcaacacgaatgggtaacgtacgaatttttagattttccctggacaccg
gttgttgaccattatttcctgaccgaacagccgaaagcgttgcttgagtcgggtcagttc
aagaagtgtgaattgctgttgggcagcaaccacgacgaaagcatctatttcatcgtctac
tacgtggacaagattttcaaacgtgacgaagtgttcactaaacaagaattcttggtcgac
gatcgtctgttcgaacaagcagtttatgcactgcttccgcaaaagtatcggaaaaatcca
atagtgcatcgtgctattctgttcgaatataccgacttcgaccgtccagcaactgctcaa
cgacgccagcaagctttggacaaaatgttcggcgattatcatttcacgtgcggtgtcaat
gaatttgcacgtcgatttcgagaccacggttcaccagtttacagctactatttcactcaa
cgttccagtgaacaacagtggccagagtggatgggcgtgttgcatggatacgagattaat
tacgttttcggtgaacctctaaatgtgaaacagtttgcttataccgaagctgaaaaagac
ttggctcgacgcttcatgcgctactgggcaaactttgcccgtacaggcaatccaaatgta
aacccggatggaacttggacaccagaactatggccaaaatattctcaagatgaactttat
ttaattctatccgcttcgacaaacggtaccggacatggaccacgtagaagacagtgcact
ttctggagtcagtacatcccgaagctgttcgccgctacggctagcttgagtgatgtcgag
atgaagtggaaaatacaaatgatgaaatgggaagaagagtacattgccgaatggaaacat
catttcgaaatgtacaaaaaaatacagcagcacagctatatggatacttattgtcgtaat
tga

DBGET integrated database retrieval system