KEGG   Trichinella spiralis: Tsp_04303Help
Entry
Tsp_04303         CDS       T01609                                 

Definition
putative HEAT repeat-containing domain protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tsp  Trichinella spiralis
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Tsp_04303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1556 aa AA seqDB search
MSEENDLHEKEPERVPVSFADLRREQCDADNKIDPEFWRNRERMKTVSVALVLCLNIGID
PPDTVKPKPCARTECWIDPQCMPMQKALESIGTALQRQYQWWQPRARYKQALDPTVDDVR
RLCISMRKNAKEERVLFHYNGHGVPRPTKNCEIWVFNKMFTQYIPLAIYDLQTWMGAPGV
YVWDCNGAAQAIRAFKTCAKKQIQAYRCSLAARRKESTKTTVEFEPGVDLFQADDARQAE
LDRSHRRKTGLDCVSSKPLEVNFRSSSMVPNDPKIETNNKTTAKDASKHLTGNSSGNNNH
CIQLAACARDQTLPTDPALPADLFTCCLTTPIRMAVMYYILQNKLTDRYPVCIADRIPGS
TGDRRSPLGELNWIFTAITDTIAWNLLPSETFQRLFRQDLLIASLYRNYLLADRVMRSYY
CTPVSSPRLPPTHEHVMWQAWDMVVESVLEQLDVQALVAEVEANEATVMLPPGVPTAAGH
GGAGVGAGASTAVAAAAMPGGGTATTGVSDAGSRAVGNDPTLTAGQQAQHDKQSAYRVRS
LAPVRLLPGFGSSAVANSVASVAESSVARASARTVGQVRRSGTESGGTSAGGGHFPLHPA
PVAECFQGHAPVVDVHLGENTGRRQLLPTDVAQGPRPSVLFGPPQRPDGRGSPEIVRRVR
FGSPDGRLPPIPRSGFVQRDCNDAPMRQWLALALGHLWTDYEAAKWQAIRCSLHQTLIGL
LEDRLASVRAAAVFALGRLISTGGSGDKENKQNDGDQGNHCPNDEQSTNLAHSVAMSLVQ
HVCADSSATVRREALLGFFAFVRRFYPQFVTIAYEIDRELASSVPSRRHQHHELVSSYTV
TTATIRTRNFGISSSPVAANVDSSTLVKSTSLLFQPLLTAVSSSLNSSSNSMINIPLVRP
SSRKSVSWLFGLARSSQEHQKVDNSKQEQSSQETITVLSRREVRRHRSIGPAALVNVNNV
YVSVWRAVLKFLYDPDIEVSRLAHRLFKYVDRSVQNLRLLSSVGHQDSVDSLPVRRRSTA
GYFHSSPDNGTAGQHPSPRPKFSFSGTHDHHQQQLVNDGNGNSGGCESPMGVSPITLCTY
SAIYTNPRRPVFGDGPASESSVHSSEASPETRRHLAPEREIGTTAASILSPPVDGEPVMK
TDYLSTCAQQFRSPMFYLLSESSAPSPAALNAQPRTTQRILPSFIADRISLIHQHSSIEW
KDKRKKYGKLWTYKNDFPATCMEFLPLEPLLCIGERDSVTVWNCNKGSVVAHFDNSSTSY
TGQSGSDLSGNLVYLTFVNPYTHGFILTGTDCGEVRVWDVRLINEPDLTSKVPKGSIDFA
LLTAWMCADDARRFHTKPFTCYFWEQDPGLLFAAGDFRNIILWDAHTELKLAELKVGAGG
DTYVCSLSADSNGHHLTAAGCSDGSVRLFDRRLPTSDSRIMTLRDLGRAVFKVHLEQASV
GGGGGGGGRLVAASRSGQLCIWEPRMYREPVLFKDVGVRCRSSFDVHRNYPLIAAWNGAQ
VDLINFDGKSMGLFRPDVSNMTTTLGRLAALRFHPVQVSIGLAEQDGQFSLYGLRP
NT seq 4671 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagaatgatttgcatgagaaggagcctgaacgtgttccggtatcgtttgcc
gacttgagacgcgagcaatgtgatgcggataataaaattgatccagaattttggcgcaac
agagagcgcatgaaaactgtttcagttgctttggtgctttgcttgaacattggcattgat
ccacctgacactgtgaagcccaaaccgtgcgccagaaccgaatgctggatcgatccgcag
tgtatgccgatgcaaaaagctctcgaatcgattggtactgctttacaacgacaatatcag
tggtggcaacccagggctaggtataagcaagcattagatccgactgtagatgatgtcagg
agattgtgcatctcaatgcgtaaaaatgccaaagaagaacgtgttcttttccattataat
ggccatggagtgccgaggccaacgaaaaattgtgaaatttgggtttttaacaaaatgttt
acccagtacatcccattggccatttacgacttacagacgtggatgggtgccccaggtgtg
tacgtctgggattgcaacggtgcagctcaagccatacgagcattcaagacttgtgcgaag
aagcaaatccaagcttatcgctgttcgttggcggcaaggagaaaagaaagtactaaaaca
actgttgaatttgagccaggggttgatctcttccaagctgatgatgcaaggcaagcagaa
cttgatcgttcgcatcgacgcaaaacgggtttggattgtgtgtcgtcgaaaccattggaa
gtgaattttcgatccagttccatggtaccgaatgaccctaaaattgaaacaaacaacaaa
acaactgccaaagatgcaagcaagcatttgacaggcaacagcagtgggaataacaaccac
tgcattcaactggcggcctgtgcacgagatcagacattgccaactgacccagctttgcct
gccgatttgttcacttgttgcttgaccacgccgattcggatggcagtcatgtattacatt
ttgcagaataagctgactgaccggtatccagtatgtatagccgaccgaataccgggctct
acgggtgatcgtcgttctcctttgggggaactgaattggattttcacggcaattacggat
acaattgcttggaacttgcttcccagcgagacgtttcagcgtttgttcaggcaagatttg
ctcatagccagcttgtacaggaattacttgttagccgaccgtgttatgcgcagctattat
tgcacgcctgtatcgagtccacgtttgccgccaactcacgagcacgtcatgtggcaagct
tgggatatggtagtcgagtcggtactggagcagttggacgttcaggcgctggtggctgaa
gttgaagccaacgaggcgacagtgatgctgcctccgggcgtgccgaccgcggctggtcac
ggcggtgctggcgttggtgccggtgccagcacagcagtggctgcagcggcaatgccggga
ggcggcacggcgacgactggcgtgtcggatgccggcagtagagcagttggcaacgatccg
acgttgaccgccggccaacaagcacagcacgacaagcaatcagcttatcgcgttcgaagt
ctggctccagtacggcttttaccagggttcggctcctcagcagttgccaatagtgttgca
agtgttgctgagtcaagtgttgcgcgtgcgagcgctcgaactgttggccaggttcgtcga
tctgggaccgaaagcggtggaacaagcgctggcggtgggcattttcccctacatcctgcg
cctgttgcagagtgtttccagggacatgcgcccgttgttgacgttcatctgggcgaaaat
actggccgtcgacaactcttgccgactgatgttgctcaaggaccacgtccatcggtactt
tttggtccacctcaacgacccgacggtcgaggttcgccggaaattgttcgccgtgttcgc
tttggctcgcctgatggccgactgccgccaattccaagaagcggctttgtgcaacgcgac
tgcaacgacgcgccgatgcgccagtggctggcgttggcgttgggccacctctggaccgac
tacgaggcggccaagtggcaggcgattcgctgctctttgcaccagaccctgatcggcttg
ttggaggatcgtttggcgtcggttcgggcggcggccgtgttcgctttgggtcgactgatc
agcaccggtggttccggcgacaaggagaataagcagaacgacggtgaccaggggaaccac
tgccccaacgacgagcagagtacaaatttggcgcacagtgtcgccatgtctctggtccag
cacgtctgcgccgacagttcggccactgttcgacgcgaagctttgctcggctttttcgcc
ttcgtccgtcgtttctatcctcaatttgtcaccattgcctacgaaatcgaccgtgaactt
gcttcatcggtgcccagtcgacggcaccaacaccacgaacttgtatcatcttatacggtc
acaactgctactattcgtacccgtaactttggcatctcttccagtccagttgccgccaac
gtcgactcgtctactttggtaaaatcgaccagtttgttgtttcaaccgcttctcacggct
gtttcttcatcactgaattcgtcttcgaattctatgatcaacattccactggttcgcccg
agctctcgaaaatccgtgtcgtggctattcggattggctagatcatcccaggagcaccag
aaagtggacaattcgaaacaagaacaatcgtctcaggaaacgataactgttctcagccgc
cgggaagtccgcaggcatcgttccattggtccggcggcgttggtcaatgtgaacaacgtc
tacgtgagcgtttggcgagcggtgttgaaattcttgtacgaccccgacattgaagtgtct
cgactagcgcacaggcttttcaaatacgtcgaccgatctgtgcagaatcttcggctattg
tcatccgttggccaccaggacagcgttgacagtttgcctgttcgacgtcgatccacggcc
ggctacttccactcgagcccggacaacggtacggccggacaacatcccagtcccaggccg
aagttcagtttcagcggcacgcacgatcaccaccagcagcagctggtgaacgatggcaac
ggcaacagcggtggttgtgaatcaccaatgggagtgtcgccgatcacgctgtgcacatat
tcggccatttacaccaatcctcgtcggccggtgttcggcgacggtccagcaagtgagtcc
agtgtccactcgagcgaggcaagtccagaaacgagacgacatttggccccggagagggaa
attggaaccacagcggcaagcatacttagcccacctgtcgacggtgaaccagtgatgaaa
actgactacttgtcaacttgtgcacagcagtttcgatctccaatgttctacttgctttcc
gaaagcagtgcaccgtcacccgctgctttaaacgcgcagccgcggaccacgcagcgaatt
cttcccagtttcatcgccgatcgaatcagcttaattcatcaacatagcagtattgaatgg
aaagataaaaggaagaagtacggaaaactttggacgtataaaaacgattttcccgcaacg
tgcatggaattcttgcctttggagccgttgctgtgcatcggtgaacgagactcagtgacc
gtttggaattgcaacaaaggcagcgttgtggcgcatttcgacaactcttcgacctcgtac
actggtcagagtggtagcgatttgtccggcaatcttgtttacttgactttcgtgaatccc
tacacgcacggcttcatcctcaccggaaccgactgcggcgaagtgcgcgtctgggatgtg
cgtttgatcaacgagcccgacttgaccagcaaagtgccaaagggaagtattgatttcgca
ttgctcacagcttggatgtgcgccgacgatgcgcggcgttttcacaccaagccattcacc
tgctatttctgggaacaagatccgggtttgttgtttgccgctggcgatttcagaaatata
atattgtgggatgcgcacacggagctgaaattggctgagctcaaagtgggtgccggcgga
gatacgtacgtgtgctctttgtcagccgattccaacggacatcatttgacagctgcaggt
tgtagtgacgggtcagttcgactattcgatcgtcgcttgccgacatccgattctcgcatc
atgactctgcgggatttgggacgtgcagttttcaaagtccatttggaacaagcatccgtc
ggcggcggcggcggaggaggaggacgtcttgtggccgccagtcgtagtggtcagttgtgc
atctgggagccgcggatgtatcgagagccggtattgttcaaagatgtcggcgttcgatgt
cgtagctctttcgatgtgcaccgtaactatcctctgattgccgcttggaacggcgcgcag
gttgatttgatcaacttcgatggaaaatccatgggtctattcagaccggatgtttcgaac
atgacaacgacactgggtcgtcttgcagctttacgttttcatcctgttcaagtgagcatc
ggcttagctgaacaggatggccaattctcactctacggtctccgtccttga

DBGET integrated database retrieval system