KEGG   Trichinella spiralis: Tsp_04340Help
Entry
Tsp_04340         CDS       T01609                                 

Definition
(RefSeq) ubiquitin carboxyl- hydrolase 33
  KO
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Tsp_04340
Peptidases [BR:tsp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Tsp_04340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 483 aa AA seqDB search
MLTLQECSFLVSHNKEIFQDISLSIPNLEQLVLMQNASINGNEYVSPSSIANQSWLSWLT
LRFKEYISRMDLTLSDCLKLFFSPEDLRGDDMYRCDRCKSLQPGVKICRLLKTPQILCIH
IKRFRHEASSSFKLNNRIGFPLEGLDLSDFVQGRSSDLHTYNLVAVISHSGHADAFCHHL
YLGGHYVSYCMNHSNYRWYLFDDETVTAVDPCTVENVEAYVLFYEKTSNTIGFVREQASA
LFENSHLLSPVETSFYYISMEWVIRLSTFAEPGPVNNYSFLCRHGLVNVKKLSSMHNYCL
KLSPSLWNYLRVKFGGGPVCRHLKHCIICSAYQEAFESRRKHELSKFYRYQNDDEYFISK
SIADENHDFASSSRLICTKWLRRWKAFVFAETDELPGPIDNSCMVPVPLRNGSAKTISIE
VSDLLPSKTIRCCGQLIVHELILPHCLRCLLFDHRQWTLTALPMNQITLSDAVGRCSMFY
ANC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgttgcaagagtgttcgtttctagtatcccataataaagagatatttcaagat
atttcgttatctattcccaatctggagcagttagtactgatgcaaaatgctagtattaat
ggtaatgaatacgtttcaccatcgtcaattgcaaatcagagctggctttcatggttaaca
ttacgctttaaagaatatatctcacgcatggatctaacgctaagcgattgcttgaaatta
ttcttctctccagaagatctcagaggtgatgatatgtatcgttgtgatcgctgtaaaagt
ttgcaaccaggggtgaaaatctgccgcctgctcaaaacacctcagatactttgtattcat
attaaacgttttcgccacgaagcatcgtctagctttaaactcaacaatcgcataggcttt
cctctggaaggacttgatctcagcgattttgttcaaggtcgctcaagtgacttgcacacc
tacaacttagtagctgtaatatcacattctggccatgcagatgcattttgtcatcattta
tacttaggtggacattatgtttcttactgtatgaatcattcaaattatcgatggtattta
ttcgatgatgaaacagtgacagctgttgatccatgtacagttgaaaatgtagaagcttat
gtgttattttatgaaaagacatcgaacacaataggatttgttcgagaacaagcaagtgca
cttttcgaaaattctcatctactgtcacctgtcgaaacatcattttattacattagcatg
gaatgggtgattcgtttgtcaacgtttgctgaaccaggtccagtgaacaattattcattc
ttgtgtcgacatgggcttgtaaatgtgaaaaagctaagctccatgcacaactattgcctc
aaactgagcccgagtctttggaattatcttcgtgtcaagttcggaggtgggccagtttgt
cgccatctaaagcattgcattatttgttccgcttatcaggaagcgtttgaatctcgccgt
aaacatgaactttcaaaattctatcgctatcaaaacgatgatgaatatttcatttctaaa
tcaatagctgacgagaatcacgattttgcatcttcatcgcgtttgatttgtaccaaatgg
ttgcgtcgatggaaagcatttgtttttgccgaaacagatgaattgccgggtcctatagac
aacagttgcatggttcccgtccctttgcgcaacggatctgcgaagacaatcagcatagaa
gtgtcggatttgttaccaagtaaaacgatacgttgttgtggtcaattaattgtgcatgaa
ttaattttgccgcactgtttacgttgtttactgtttgatcaccgtcagtggaccctcact
gcgttgccaatgaaccaaataaccttaagtgatgctgttgggcgttgttcaatgttttac
gctaattgttaa

DBGET integrated database retrieval system