KEGG   Trichinella spiralis: Tsp_04349Help
Entry
Tsp_04349         CDS       T01609                                 

Definition
serine/threonine-protein kinase Doa
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Tsp_04349
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Tsp_04349
Spliceosome [BR:tsp03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Tsp_04349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 750 aa AA seqDB search
MFERRFALVYTKLIVGRKLSPCLDSGAVRTSGHRISLDSPVENRLPQAAVVDGYLHHFPQ
QQHNQRQQQQQQQHPHQKYQQQQQQHHHHHHHLQQPLRRRRRLGWEVYGHPLLKELQSFA
DTLRDLDGSTVSVQRRAGPSPPMPLNAAANATVQHAPIPPPRRRRRTIAVVPVSLSRSDP
SLYVVDFPVQASSGEAVDNGGKGAEEVAGAEVALSAMLDRFAIFEPASGVVQQLQPTTSL
QKKDSKGGGKNVYYQYPCPFSRPNILAEAVDVVPPPPPPPPSTDGVATLVAAAAPEQEVK
APLLPVASALSNQQQQQQQQQQQSSPPVVEQDVNDRPLHYTLGRREGLASIDIVKSSSAE
VLVAWNVADGCIICDAHVHRMLNCHHNRNTAILAFDRSFWEIIDTRCHDAYHIVQRSESR
RSSDDGLIRDDKHDEVIKTLGEGTFGRVVQVRDHENEQSEPLALKIIKNVDKYREAAKLE
VNSLHSFGPSFQLFRAHVSGFPYDGIELMHQNHLTHTDLKPENLLFVHPEYDIKIDMKRN
KEYRIIRDTSVRVIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSHPCDVWSIGCIIF
ELLLGTTLFQTHENLEHLAMMERILGPLPYRMCRKTNVSRKMTFQDTLFLSRAFRLGHKT
SFWTRYLLAGDVEHEEIFDIVSCMLEYEPSQRIKLADSLEHRFFHRLPENQKLHKSSSSR
NQTVSDFSGSLKGCCSTSSLLSEEFSSVAD
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacgacggtttgctttggtctacacgaagctgattgtcggccggaaactttca
ccttgtctggacagtggcgctgtgcggaccagcggccatcgaatctcattagacagtccc
gtcgaaaaccgcttgccccaagcggcggtggtcgacggatatttgcatcattttccacaa
cagcagcataatcagcgacaacagcaacagcaacaacaacatcctcatcagaaatatcag
cagcagcagcagcagcatcatcatcatcatcatcatttacagcaacctttacgacgaagg
cggcgtcttgggtgggaggtttacgggcaccctttgcttaaagaattgcaaagctttgct
gatactttgcgtgatttggatggctctaccgtgtcggtccagcgtcgagctggaccttcg
ccgccgatgccgctgaacgctgctgccaacgccactgtccagcatgctcccattccaccc
ccgcggcgccgtcgccgcacaattgccgtcgtgcctgtttctctgtctcgcagtgatccg
agcttgtacgttgttgatttcccagtccaagcttcttctggtgaagctgttgacaacggt
ggtaaaggtgccgaagaggtcgccggtgccgaggtggcgctcagcgcaatgctcgatcgg
tttgctatttttgagccggcatccggtgtggtgcagcaattgcagccgacgacaagctta
caaaagaaggacagtaaaggtggtgggaaaaatgtctattaccaatatccctgcccgttc
agtcgaccgaacattctggccgaggctgttgacgttgtacctcctcccccgcctccgccg
cctagcactgacggcgttgcgacgcttgttgcagcagctgcgccagagcaagaggtaaaa
gcacctttgctgccggttgcttctgcgctttcaaatcagcagcagcagcagcagcaacaa
caacagcaatcttctcctccagtcgttgagcaggacgtaaacgatcgaccgttacattac
acattgggcagaagagaaggtttagcaagtatcgatattgtaaaaagttcttctgctgag
gttcttgttgcttggaacgttgctgatgggtgcataatatgcgatgcacacgtccacagg
atgttgaattgtcatcataaccgaaatactgcgatcttggctttcgatcgctcattttgg
gaaatcattgatacgagatgtcatgacgcttatcacattgttcagagatctgaaagcagg
cgaagcagcgatgatggactgattcgagatgacaagcatgatgaagtgattaaaaccctt
ggcgaaggtacgtttggtagggtggtccaggttcgtgatcacgagaatgaacaaagtgag
ccgttggctttgaaaattattaaaaatgtcgacaaataccgcgaagccgccaagcttgaa
gtcaactctttgcattcatttggtccatcatttcaactatttcgggcacatgtgtctggt
tttccctatgatgggattgagcttatgcatcagaatcacttaacgcacacagatttgaag
ccggaaaatttgctatttgtccatccggaatatgacatcaaaattgacatgaaaagaaat
aaagaatatcgtattattcgggatacgagcgttcgagtgattgattttggttctgctaca
ttcgaccatgagcatcacagtacaattgtttctactcgacattaccgcgctcctgaagtt
attctcgagctgggctggtcacatccttgtgatgtgtggagcattggttgtattattttc
gaacttcttcttggaacaactctttttcagactcatgaaaatctggaacatttagctatg
atggagcggatacttgggccactgccgtatagaatgtgcagaaagacgaacgtcagcaga
aaaatgacatttcaggacacgttatttttatcacgggcgtttagactgggacataagaca
tccttctggacgcgttatttgttggctggtgacgtagaacacgaagaaatttttgacatc
gtgtcatgcatgctggaatacgagccatcgcagcgaatcaaactagcggactcgcttgaa
catcgatttttccatcgtcttcctgaaaatcaaaagttgcacaaaagcagcagtagcaga
aatcaaacggtctctgatttctccggatctttgaaaggttgctgctccacgtcaagtctg
ctttcagaagaattcagctcggttgctgattga

DBGET integrated database retrieval system