KEGG   Trichinella spiralis: Tsp_04412Help
Entry
Tsp_04412         CDS       T01609                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tsp  Trichinella spiralis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tsp_04412
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tsp_04412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 352 aa AA seqDB search
MFRRKYDIVVIGSIVQDMSSKKAFNQFALMFLFIFMQNNTLNYAYMYLLKEKKFSYVSRM
PSLGETIFASKFVISPGGKGANQAVAAARLGASTAMIGKVGDDQFGKISIEKLIESGVNA
SKNIPSEKYHKNYRLNAFVFLAWVRTTQLDSTGVANVVVSEAGENTIIVNRGANLHITVE
DVRELSELIKNAKCLICQLEIKPEVSLEAMKMAKMSGTEVIFNAAPSTPKISEEFYHLSD
VFCVNETEAEALTGLKLTSDDQINEAVKYFLDAGVKKYAVITLGPEGCVFGSCDDRQIIH
RVPSPKVEAVDTTGAGDCFIGSLAYYNVHFQKLPFQERLRRASQVASFSVQH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcagacgcaagtatgatattgttgtgattggaagcattgtacaagacatgtccagc
aagaaagcttttaaccagtttgcattgatgtttctattcatattcatgcagaataatact
ttaaactatgcatatatgtatttgttaaaagaaaaaaaatttagttacgtttcacgaatg
ccgtctcttggggaaacaatatttgcaagcaaatttgtcattagtcccggcgggaaaggt
gcaaatcaagctgttgctgccgctcggttgggagcaagcactgcgatgattggaaaggtt
ggtgatgatcagttcgggaaaatttccatagaaaagttgattgaaagtggagtaaatgct
agtaagaatattccttcagaaaaataccacaaaaactatagattaaatgcttttgtattc
ttagcttgggttagaacaactcaactggattctactggtgtcgcaaatgtagtcgtttca
gaagcaggtgaaaataccataattgtaaaccgtggtgccaatttgcacatcactgttgaa
gatgtgcgagaattgtctgaattaataaaaaatgcaaaatgtctgatctgtcaactggag
atcaaaccagaagtatctttggaagctatgaaaatggcaaagatgagcggaacagaagtt
attttcaacgcggctccttctacgccaaaaatatctgaagaattttaccatctgtcagat
gttttttgcgtgaatgaaactgaagctgaagcacttactgggttgaaacttacatcagat
gaccagatcaatgaagcggtgaaatattttctcgatgcaggcgtcaaaaaatatgccgta
ataacactaggtccagagggctgtgtattcggcagctgtgatgacagacaaataatacac
cgtgttccatctccaaaagtcgaagcagtcgatacaacgggtgcgggagattgtttcatt
ggttcacttgcttattacaacgttcatttccaaaaactacctttccaagaacgccttcgt
cgcgcatctcaagttgcatcattttccgttcaacattaa

DBGET integrated database retrieval system