KEGG   Trichinella spiralis: Tsp_04546Help
Entry
Tsp_04546         CDS       T01609                                 

Definition
ubiquitin carboxyl- hydrolase family protein
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 389 aa AA seqDB search
MSCSFLLTAHLNMKLGMRVIKTMDRQCLMIVGTVTAASIIALALFFFMDSKERKRLRKVP
GLYNYGSVCFVNSLLQSLASCSSFVSWSAQFSNNEEYCFLKALGIILQELNDHSKYALSS
QIIINSLKQRGWNLETNIQQDVHELLNVFDSAWDEELSPLFKTVDINSDAGEAIQVPSHG
KIRSETVCHACSHKTSNLEDFGAVTLNFPTNINMPSISLEECLLCYMKPECLLDAICENC
SSVTGNVKMYKTLKFEIVKEKNIDKSTLMWLPSGMSFKIATVVNLPELLDLQHLAEIVRH
PKADQSTLPSNPSLRSCNDKLYRLEAVIVHRGNHQYGHFITYRRDIDNQSLWCAVSDDEV
KPIQFDSVTSCQAYMAFYEKAKIESNSEH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgctcatttttactcacggcacatctgaacatgaaattgggcatgcgagttatc
aaaacgatggatcgtcaatgcttgatgatagtaggcaccgttactgctgcaagtatcatt
gctcttgcattgtttttcttcatggattccaaggaaagaaagcgattgcggaaagttcct
ggattatataattatggttcagtatgctttgtaaattcacttttgcaaagcctggcaagt
tgtagcagttttgtcagttggtcagctcagtttagcaataatgaggaatattgctttttg
aaagcattgggcattattttacaagagcttaatgatcattcaaaatatgcgctgtcatca
caaattattattaatagtttaaaacagcgtggatggaatttggaaacaaatatacaacaa
gatgtgcatgaacttttaaatgtttttgattcggcttgggatgaagagttgagccccttg
tttaaaactgtcgatataaattcggatgccggagaagctatacaggtgccctcacatgga
aaaattcgaagtgaaaccgtatgccacgcttgtagtcataagacttcgaatttggaagat
ttcggagctgtgacacttaattttcctacaaatattaacatgccgagcatctctttggaa
gaatgtttgctttgttatatgaaaccggaatgtctgcttgacgcaatatgtgaaaattgt
tcctcagttacaggaaatgttaaaatgtataaaacgctgaaatttgaaattgtaaaagag
aaaaatattgataaatcaacactgatgtggcttccttctggtatgtcatttaagattgct
acggtagtgaacttgccagaactgttagatctgcaacatttggcagaaattgtacgtcat
ccaaaagcagatcagtcgacattgcctagtaatccgtcgctgagatcatgcaacgacaaa
ctttaccgtctggaggctgtaattgtgcacagaggaaaccatcagtatggtcatttcatt
acttaccggcgtgatattgacaatcaatcactttggtgtgctgtttcggacgatgaggta
aagccgattcaattcgacagcgttacaagctgtcaagcttatatggcattctatgaaaaa
gcaaaaatagaatccaactcggaacattga

DBGET integrated database retrieval system