KEGG   Trichinella spiralis: Tsp_04710Help
Entry
Tsp_04710         CDS       T01609                                 

Definition
putative clathrin heavy chain 1
Orthology
K04646  
clathrin heavy chain
Organism
tsp  Trichinella spiralis
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Tsp_04710
   04142 Lysosome
    Tsp_04710
Exosome [BR:tsp04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tsp_04710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1447 aa AA seqDB search
MTTSLPIRFQEHAQLQNLGISASNIGFSTVTMESDKYICVKEKVGDSAQVVVIDLNDISN
PMRRPISADSVIMNPVSKVLALKAGKMLQVFDIDVKSKVKSCQFSEEVVFWRWLDVNNIA
LVSPTSVYHWTMESESVPVKMFDRMQSLSDRRIINYKADSKYMWLLLMGIFGKNEEPSTL
FSFASRQQAFAKLHIVEVGTASGKNATYTKKVVDLFFPAEGQHDFPIAMQGSEKHGVIFI
ITKCGYIHVYDVEFAVCIYMNRISNETIFVTTEYQLTSGILGITTKGQVLSVSIDEQNVI
PYITNTLQNPDLAMRFAARCDLPGAEDLFVRKFTTLFNEQRYSEAAEIAAVAPKLECSEE
LGDLIQAQGKDTTLALSVYLRSHCHPKVILCFAETGSFDKILLYAKRVGYQPDYVFLLRQ
VIQKSGPEKAVEFARMLIKDEERPLADLNQIADCFLEVNLVPQCTAFLLDALKNDRPSEG
PLQTRVLEINLLTNPAVADTILQQNIFHHYDRAHIAQLCEKVSLMQRALEHYTDLYDIKR
AVVNTQSLNLDAACRTGQIKEVERICRESTFYEPERVKNFLKEAKLTDQLPLIIVCDRFD
FVHDLVLYLYQNNLHKYIEVFVQKPWLETKVHEGATDAATHNAIAKIYIDSNNNAERFLR
ENPYYDSRVIGKYCEKRDPHLACIAYERGHCDTELINVCNENSLFKNLSRYMVCRRDSEL
WNQVLQESNPYRRQLIDQVVQTALSETQDPDDVSVTVKAFMAANLPNELIELLEKIVLDN
GLFSEHRNLQNLLILTAIRADRPRVMEYVQRLENYDAPDIANLAITSELYEEAFAIYKKF
DVNTSAIKVLIDNIGNLDRAYEFAERCNESGVWAQLAAAQLRHNMVKEAVDSFIKADDAS
YYVEVVQTCSKTDHWEDLVRYLKMARKKARESFIDTELVFAFAKTKRLAEMEDFVTGPNH
AQILQVGERCFDEGMYDASKILFNNVSNFAKLAITMVRLGEYNGSVDAARKANSTKTWKE
VTVVELLKIAIYLYVQFVPQVCYACVDAEQFQLAQTCGLHIVVHAEELEELNTYYQQRGY
FEELINLLEAALGLERSHMGIFTELAILYSKYKPEKMREHLELFWSRVNIPKVLRAAEQA
HLWAELVFLYDKYEEYDNAVVTVMKHPVEAWREQHFKEIITKVANIELYYKAMQFYLDYK
PLLLNDLLTVLAPRMDHTRAVAFFTKNKHLPLIKPYLRAVQNQNNKAINEALNQLLIEEE
DYAGLRASIDAFDNYDNIALAQQLEHHELIEFRRISAYLYKGNNRWKQSVELCKKDKLYK
DAIEFAAESRQSELAEDLISYFLENNLKECFAATLYQCYDLLHPDVILELAWRHDLMDFA
MPYMIQVLRELTTTLMLTYGMNAPAVAMPHQQQQQQQSAQPGSAAAYSTNAYLGSALYSS
YPGYRMP
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatctctacctattcgatttcaagaacatgctcagctgcaaaatctgggcatc
agcgcttctaacatcggtttcagtactgtgacaatggaatcggataaatacatttgcgtt
aaagaaaaagtgggagattctgcccaagtggtcgtaatcgatttgaatgacatcagcaat
cctatgcgaagaccgatttctgcggattcagtaattatgaacccagtttcaaaagttctg
gctttgaaagcaggaaaaatgctccaagtattcgacatagatgtgaaaagcaaagtgaaa
tcatgtcagttttcggaagaagtagtgttttggagatggcttgatgtgaataatattgca
ttggtttcgccgacatcagtttatcactggacgatggaaagtgagtctgttccagtgaaa
atgttcgatagaatgcagtcgctcagtgatcgtcgaattatcaattacaaagcagatagc
aaatacatgtggcttcttttgatgggcatatttggcaaaaatgaagaaccaagcacgttg
tttagttttgcctcgcgacagcaggcttttgcaaagctacacatagttgaagttggaact
gcatctggtaaaaatgcgacgtataccaaaaaagtggttgacttgttttttccggcagaa
ggtcagcatgattttcccatcgcgatgcagggaagtgaaaagcatggtgtgatttttatc
attacaaaatgtggttacattcatgtttatgatgtggaattcgcagtttgtatttatatg
aatcgaatttcaaacgagacaatcttcgtgacaactgaataccaattaacatctggaatc
cttggcattactacgaagggtcaggtgctaagcgttagcattgacgaacagaatgtcatt
ccatacataacgaatacattgcaaaatccggatttagctatgcgttttgcagctcgatgt
gatttgccaggtgccgaagatttgtttgtacgcaagtttaccactctcttcaacgaacaa
agatatagcgaagcagcggaaattgctgcagtagctccaaaattggagtgcagtgaagag
ttgggcgatttgatccaagcacaagggaaagatacgacgttggcgttgtcggtgtatttg
cgttctcactgccatccaaaagttattttgtgctttgccgaaactggcagttttgacaaa
attcttttgtatgcaaagagagttggctatcagccggattatgtgtttctattgcggcaa
gtgattcagaaaagtggaccggaaaaagctgtcgaatttgcacgtatgttgattaaagac
gaagaaagacctttggcagatttgaatcagatagcagattgctttttggaagtaaatctc
gttcctcagtgtactgcatttttgttggatgctttgaagaatgatcgaccgtcagaaggt
ccactacaaacacgcgtgttggaaattaatcttttgacaaatccagcagttgccgataca
attctccagcagaatattttccatcattacgatcgtgcgcacattgcgcagttgtgtgaa
aaggtttcactgatgcaacgtgcactggaacattacacagatttgtacgacatcaaacgg
gctgtggtcaatacccagtctttgaatttggatgcagcttgtcgcactggacaaatcaaa
gaagtagagaggatttgtcgtgagtcgaccttctacgaaccggagcgtgtgaaaaatttt
ttgaaagaagcgaaacttactgatcaactccctttgattattgtctgcgatcggttcgac
tttgtccacgatcttgtactctacttgtaccagaacaacttgcacaaatatattgaagtt
tttgtgcagaagccgtggttggagactaaagttcacgaaggtgccaccgatgctgccacg
cacaacgctattgcgaaaatttacattgatagcaataacaatgccgagcgtttcttgaga
gaaaatccctattacgattcgcgggttattggaaaatactgcgaaaagcgtgatccacat
ttggcttgtattgcctacgaaagggggcactgcgatacggaactgatcaacgtttgcaac
gagaattcgttgttcaaaaatttatcccgctacatggtctgtcgcagggacagtgaactg
tggaaccaagtgctgcaggagagcaacccgtacagacggcagttgatcgaccaagtggtg
cagaccgcgttgtccgaaactcaagatccggacgatgtgtcggtgacggtgaaagcgttc
atggctgccaatttacccaacgaactgatcgaattgctcgagaaaattgtcctggacaac
ggcttattttccgaacatcgcaatttgcaaaatttgctcattttgaccgcaatccgagcc
gaccggcctcgtgtgatggaatacgtccaacggttggaaaattacgacgcgccggatatt
gccaacttggcaatcacatccgaattgtacgaagaagcatttgcaatatacaaaaagttc
gacgtcaacacatcggctataaaggttttaatcgacaatattggcaatttggaccgtgct
tacgagtttgccgaacgttgcaacgaatctggcgtttgggctcagttggccgcggcgcag
cttcgtcacaatatggtcaaagaggctgttgattctttcatcaaagctgacgacgcttct
tattacgtggaagtggttcaaacttgcagcaaaacagatcactgggaagatttggtgcgc
tatttgaaaatggccaggaaaaaagcacgcgaatcgttcattgataccgaattggttttc
gcatttgccaaaaccaaacgtttggccgagatggaagatttcgtcacaggaccgaatcat
gctcagattttacaagttggggaacgttgttttgacgaaggcatgtacgatgcgtcgaaa
attttattcaacaatgtcagtaattttgccaaactggcgatcacgatggtacgtcttggt
gaatacaatggatctgtcgatgcggcaagaaaggcaaattcgaccaaaacttggaaagag
gtaacagtagtagaactgttgaagattgcaatttatctgtatgtacaatttgtcccacag
gtgtgctatgcgtgcgtggatgcggaacaattccaactggcccaaacatgcggattgcac
attgttgtccacgccgaagagctcgaagaattgaatacttattatcaacagcgtggctat
tttgaagagttgatcaatttgctcgaagctgcattgggattggaacgttctcatatgggc
atttttaccgaacttgcaattttgtattcgaaatataaaccggaaaagatgcgtgaacat
ttggaattgttctggtcaagggttaatattccgaaagtgttgcgcgccgctgaacaagcc
catctgtgggcagagttggtcttcttgtacgacaaatacgaagaatacgacaacgccgta
gttactgtcatgaagcatccagtagaagcttggcgtgagcagcatttcaaagaaatcatc
accaaagtggcgaacattgaactctattacaaggcgatgcaattttaccttgattacaag
ccgttactgttgaatgatctgctgaccgtcctggctcctcgtatggatcatacgcgagct
gttgcattttttacaaaaaacaaacatctaccactgataaagccctacctgcgagcagtg
caaaatcagaacaacaaagctataaatgaagcgttgaatcaactgttgattgaagaagaa
gattatgctggtcttcgtgcttctattgatgcatttgacaactatgataacattgctctg
gctcagcagcttgaacatcatgaactgattgaattccgtcgcatcagtgcttacttgtac
aagggtaacaatcgctggaagcagtctgtcgaattatgtaaaaaggataaattgtacaag
gatgcaattgaattcgcagcagaatctcgccaatcagaacttgcggaagatttgatctct
tactttttggagaacaatttgaaagaatgctttgcagcgactctttatcagtgttacgat
ttgctgcatccggacgtgattttggaactggcatggagacatgatctgatggatttcgcg
atgccttatatgattcaagttcttcgcgaactcaccactacgttgatgttgacttatgga
atgaatgccccggctgttgcaatgccccatcaacaacagcaacaacaacagtctgcacag
cctggttcagcggcagcgtattctacaaatgcatacttgggttctgccctgtattccagc
tatcccggttatcgtatgccatag

DBGET integrated database retrieval system