KEGG   Trichinella spiralis: Tsp_04731Help
Entry
Tsp_04731         CDS       T01609                                 

Definition
putative FATC domain protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tsp  Trichinella spiralis
Pathway
ErbB signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tsp04012]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tsp04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 993 aa AA seqDB search
MAHIATCSAWGLGKWEAMQDYIAEISQSTVEGCFYRAVLAVHHQNFCEAQFRIDQARDLL
DNELTAMLSESYSRAYDSIVMVQMLSELEETIDVKRNPEKRRIVPSVWWNRLQGCQRSVR
SLVLTPDEMRQMLLKFASLCRKSGKLVRLIIVDEINLQMNTFQSTVVLVQAVSRRTILTL
MDCDPDSCAPVKLPFERPEVCYAYCKQLNCEGRRDLALSQLQLLLEYGFKKPATLPAELL
SLKARCFLKLGQWSEQNLINEDSPNVEVMQHYMYATELDSKAYKPWNALACANFNALLYY
RQRAPIPLIQCQNDSGDSPLKPLNPNLLVPGTVPDDSVITMYAVQAVKCFCRAVMLCHGN
SLQDTLRQAFIQLLTLWFDYGHIPEVYDTLISRIKTVRVETWLQVIPQLIARIDTPRHFV
SHLIIEILMDIGKNHPQALIYPLTVASKSSSSARRQAADRVLKHMSDHSPNLVQQASMVS
DELVRVAILWHELWHEALEEASRLFFSDRNVKGMLDLLNPLHALIERGATTMKEQSFNQA
YYRDLKEAQELCIKFRQRGNLRDVTQAWDLYYNVFRRITKQLPLLSALDLQYVSPKLLKC
KNLELAVPGTYDPSRPLVCIQSVQRSLQVIASKQRPRKICINGSDGQEYWFLLKGHEDTR
QDERVMQLFGLVNTILLQNPTTCRLNLTIQRYSVIPLSPNSGLIGWVPNCDTLHALLRDY
REKKKILLNLEHRIMQRVNKNCCERIVTVRIVAPDYDHLPLMQKVEVFEFALEHTPGDDL
QKILWLKSPNSEVWFDRRTNYTRSLATMSMVGYILGLGDRHPSNLMLERMSGKIVHIDFG
DCFEVAINREKFPEKIPFRLTRMLINAMEVTGVEGNFRLTCEKVMSTLRANRESIMAVLE
AFVYDPLFSWKLIELSLSDDDAISLLSGGPGFQPSEFVSRKALDIIQRIRDKLTACPTTS
KSLTVQAQVDLLIQQALSHENLCQCYIGWCPFW
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggctcacattgctacgtgttctgcatggggattgggaaaatgggaagcgatgcaggat
tacatagccgaaattagtcagagtactgtcgaaggttgtttttatcgtgcagttttggca
gttcatcaccaaaatttttgcgaagctcagtttcgaattgatcaagctcgagatttgctt
gacaacgaattgacggctatgctgtcagaaagttatagtcgtgcgtatgattctattgtt
atggtgcagatgttgagcgaattggaagagacgattgatgtgaaaagaaatccagagaaa
cgcaggatcgttcccagcgtttggtggaatcgtttgcagggctgtcaaaggtcagtccgc
tcattggtcttgactcctgacgaaatgcgtcaaatgctgttaaagtttgcctcgctgtgt
cgtaaaagcggaaaattagtacgtttaataattgtagatgaaattaatttgcaaatgaac
acttttcaatccactgttgttttggtgcaagcggtttccagacgcacaattctaactttg
atggattgtgatccagattcatgcgctccagtaaagttgccgttcgaacgtccggaagtg
tgttatgcctattgcaaacagttgaattgtgaaggcagaagggatcttgcgttaagtcaa
ctgcagctacttttggagtatgggtttaaaaagccggctactttgcccgctgaattgctg
agtttgaaggcgagatgctttctgaagttaggccagtggagtgaacagaatttgatcaat
gaagacagtcctaatgtagaagtgatgcagcattacatgtacgcgacagaattagacagc
aaagcttacaagccgtggaatgcattagcttgtgctaatttcaacgcactgctttattac
aggcaacgagctccgattcctttaattcagtgccaaaacgacagtggtgattctccgttg
aagcctttgaatccaaacttgctagttccaggcactgtgccagatgacagtgtgattaca
atgtatgctgtgcaggcggtgaaatgtttttgtcgagcggtgatgctttgtcacggaaat
agtttgcaagataccctcaggcaagcattcattcaactgctcactctttggtttgattat
ggtcacataccggaagtgtacgatacattgataagtcgaatcaaaactgttcgagtggag
acttggcttcaagtgattccacagcttattgcaagaattgatactcctaggcactttgtt
agtcatttgattatagaaattctaatggatattggcaaaaatcatccacaggcgttgatt
tatccacttacggtagcatcgaaaagcagcagttctgctaggaggcaggcggcagatcgc
gttttgaaacacatgagcgatcactcgccaaatttagttcagcaagcttcgatggtcagc
gatgagcttgtccgtgtggcaatactttggcacgagctttggcatgaagctttggaagaa
gctagtcgactatttttctcagatagaaatgtcaaaggcatgctggatttgttgaatcca
ttgcacgcattgatcgagcgtggggcgaccacaatgaaagagcagtcattcaatcaggct
tattaccgagacctgaaagaggcgcaagaactgtgcataaagttcagacaacgtggtaat
cttcgagacgtaacccaagcctgggatctatattacaacgtattccgacgtattactaag
cagcttcctttgctttcggcacttgatctccaatatgtctcaccgaagttattgaaatgc
aagaatttggaattggccgtgccaggcacgtacgatccatctcgtccattggtctgcatt
cagagtgtacaacgcagtttgcaggtgattgcttcaaagcaacgccctcgcaaaatttgc
attaacggaagcgacggtcaggaatattggtttttgctcaagggacatgaagatactcgt
caggatgagcgggttatgcaactgtttggtttagtgaacacaatactgcttcaaaatccg
accacttgcagattgaatttgacaatacaacgatattctgtaattccgcttagtcccaac
agtggtttgatcggttgggttcctaattgtgacacgttgcacgctctgttacgcgactac
agggagaaaaagaaaattttattaaatctcgaacatcgaatcatgcaacgggtaaataag
aattgttgtgaacgaattgtcaccgtgcgcatcgtagcccctgattatgatcatctgcct
ctgatgcaaaaagtggaagtttttgaatttgctttggaacacacgcccggcgacgacttg
caaaaaattctttggctcaagtcaccaaattcagaagtttggttcgaccggagaacaaat
tacactcggtcgctggccaccatgtccatggtgggttacattttgggtcttggagacaga
catccttcaaatttgatgctggaacgaatgagcggcaaaattgtacacatcgatttcggt
gattgctttgaagtggcgattaacagggaaaaatttccagaaaaaatcccgtttcgttta
acgcggatgctgatcaacgcgatggaggtcacaggggttgagggcaatttccgtttgact
tgtgaaaaagtgatgtctacccttcgtgcaaaccgggaaagcatcatggcagtgttggaa
gcatttgtttacgatccgctgtttagctggaaattgattgaactgagtcttagcgatgat
gacgctatttctttattgtccggtggtccgggttttcaaccgtcagaatttgtaagcaga
aaagctttggatattatccaacgtattcgtgacaagctgacagcctgcccaacaacatcc
aaatcgttaactgttcaagcccaagtggacttgctcatccagcaggcgttgtctcatgaa
aatctttgtcagtgctatatcggctggtgcccgttttggtga

DBGET integrated database retrieval system