KEGG   Trichinella spiralis: Tsp_04731Help
Entry
Tsp_04731         CDS       T01609                                 

Definition
(RefSeq) putative FATC domain protein
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
tsp  Trichinella spiralis
Pathway
ErbB signaling pathway
mTOR signaling pathway
Longevity regulating pathway - worm
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    Tsp_04731
   04150 mTOR signaling pathway
    Tsp_04731
 Organismal Systems
  Aging
   04212 Longevity regulating pathway - worm
    Tsp_04731
   04213 Longevity regulating pathway - multiple species
    Tsp_04731
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tsp_04731
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Tsp_04731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 993 aa AA seqDB search
MAHIATCSAWGLGKWEAMQDYIAEISQSTVEGCFYRAVLAVHHQNFCEAQFRIDQARDLL
DNELTAMLSESYSRAYDSIVMVQMLSELEETIDVKRNPEKRRIVPSVWWNRLQGCQRSVR
SLVLTPDEMRQMLLKFASLCRKSGKLVRLIIVDEINLQMNTFQSTVVLVQAVSRRTILTL
MDCDPDSCAPVKLPFERPEVCYAYCKQLNCEGRRDLALSQLQLLLEYGFKKPATLPAELL
SLKARCFLKLGQWSEQNLINEDSPNVEVMQHYMYATELDSKAYKPWNALACANFNALLYY
RQRAPIPLIQCQNDSGDSPLKPLNPNLLVPGTVPDDSVITMYAVQAVKCFCRAVMLCHGN
SLQDTLRQAFIQLLTLWFDYGHIPEVYDTLISRIKTVRVETWLQVIPQLIARIDTPRHFV
SHLIIEILMDIGKNHPQALIYPLTVASKSSSSARRQAADRVLKHMSDHSPNLVQQASMVS
DELVRVAILWHELWHEALEEASRLFFSDRNVKGMLDLLNPLHALIERGATTMKEQSFNQA
YYRDLKEAQELCIKFRQRGNLRDVTQAWDLYYNVFRRITKQLPLLSALDLQYVSPKLLKC
KNLELAVPGTYDPSRPLVCIQSVQRSLQVIASKQRPRKICINGSDGQEYWFLLKGHEDTR
QDERVMQLFGLVNTILLQNPTTCRLNLTIQRYSVIPLSPNSGLIGWVPNCDTLHALLRDY
REKKKILLNLEHRIMQRVNKNCCERIVTVRIVAPDYDHLPLMQKVEVFEFALEHTPGDDL
QKILWLKSPNSEVWFDRRTNYTRSLATMSMVGYILGLGDRHPSNLMLERMSGKIVHIDFG
DCFEVAINREKFPEKIPFRLTRMLINAMEVTGVEGNFRLTCEKVMSTLRANRESIMAVLE
AFVYDPLFSWKLIELSLSDDDAISLLSGGPGFQPSEFVSRKALDIIQRIRDKLTACPTTS
KSLTVQAQVDLLIQQALSHENLCQCYIGWCPFW
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggctcacattgctacgtgttctgcatggggattgggaaaatgggaagcgatgcaggat
tacatagccgaaattagtcagagtactgtcgaaggttgtttttatcgtgcagttttggca
gttcatcaccaaaatttttgcgaagctcagtttcgaattgatcaagctcgagatttgctt
gacaacgaattgacggctatgctgtcagaaagttatagtcgtgcgtatgattctattgtt
atggtgcagatgttgagcgaattggaagagacgattgatgtgaaaagaaatccagagaaa
cgcaggatcgttcccagcgtttggtggaatcgtttgcagggctgtcaaaggtcagtccgc
tcattggtcttgactcctgacgaaatgcgtcaaatgctgttaaagtttgcctcgctgtgt
cgtaaaagcggaaaattagtacgtttaataattgtagatgaaattaatttgcaaatgaac
acttttcaatccactgttgttttggtgcaagcggtttccagacgcacaattctaactttg
atggattgtgatccagattcatgcgctccagtaaagttgccgttcgaacgtccggaagtg
tgttatgcctattgcaaacagttgaattgtgaaggcagaagggatcttgcgttaagtcaa
ctgcagctacttttggagtatgggtttaaaaagccggctactttgcccgctgaattgctg
agtttgaaggcgagatgctttctgaagttaggccagtggagtgaacagaatttgatcaat
gaagacagtcctaatgtagaagtgatgcagcattacatgtacgcgacagaattagacagc
aaagcttacaagccgtggaatgcattagcttgtgctaatttcaacgcactgctttattac
aggcaacgagctccgattcctttaattcagtgccaaaacgacagtggtgattctccgttg
aagcctttgaatccaaacttgctagttccaggcactgtgccagatgacagtgtgattaca
atgtatgctgtgcaggcggtgaaatgtttttgtcgagcggtgatgctttgtcacggaaat
agtttgcaagataccctcaggcaagcattcattcaactgctcactctttggtttgattat
ggtcacataccggaagtgtacgatacattgataagtcgaatcaaaactgttcgagtggag
acttggcttcaagtgattccacagcttattgcaagaattgatactcctaggcactttgtt
agtcatttgattatagaaattctaatggatattggcaaaaatcatccacaggcgttgatt
tatccacttacggtagcatcgaaaagcagcagttctgctaggaggcaggcggcagatcgc
gttttgaaacacatgagcgatcactcgccaaatttagttcagcaagcttcgatggtcagc
gatgagcttgtccgtgtggcaatactttggcacgagctttggcatgaagctttggaagaa
gctagtcgactatttttctcagatagaaatgtcaaaggcatgctggatttgttgaatcca
ttgcacgcattgatcgagcgtggggcgaccacaatgaaagagcagtcattcaatcaggct
tattaccgagacctgaaagaggcgcaagaactgtgcataaagttcagacaacgtggtaat
cttcgagacgtaacccaagcctgggatctatattacaacgtattccgacgtattactaag
cagcttcctttgctttcggcacttgatctccaatatgtctcaccgaagttattgaaatgc
aagaatttggaattggccgtgccaggcacgtacgatccatctcgtccattggtctgcatt
cagagtgtacaacgcagtttgcaggtgattgcttcaaagcaacgccctcgcaaaatttgc
attaacggaagcgacggtcaggaatattggtttttgctcaagggacatgaagatactcgt
caggatgagcgggttatgcaactgtttggtttagtgaacacaatactgcttcaaaatccg
accacttgcagattgaatttgacaatacaacgatattctgtaattccgcttagtcccaac
agtggtttgatcggttgggttcctaattgtgacacgttgcacgctctgttacgcgactac
agggagaaaaagaaaattttattaaatctcgaacatcgaatcatgcaacgggtaaataag
aattgttgtgaacgaattgtcaccgtgcgcatcgtagcccctgattatgatcatctgcct
ctgatgcaaaaagtggaagtttttgaatttgctttggaacacacgcccggcgacgacttg
caaaaaattctttggctcaagtcaccaaattcagaagtttggttcgaccggagaacaaat
tacactcggtcgctggccaccatgtccatggtgggttacattttgggtcttggagacaga
catccttcaaatttgatgctggaacgaatgagcggcaaaattgtacacatcgatttcggt
gattgctttgaagtggcgattaacagggaaaaatttccagaaaaaatcccgtttcgttta
acgcggatgctgatcaacgcgatggaggtcacaggggttgagggcaatttccgtttgact
tgtgaaaaagtgatgtctacccttcgtgcaaaccgggaaagcatcatggcagtgttggaa
gcatttgtttacgatccgctgtttagctggaaattgattgaactgagtcttagcgatgat
gacgctatttctttattgtccggtggtccgggttttcaaccgtcagaatttgtaagcaga
aaagctttggatattatccaacgtattcgtgacaagctgacagcctgcccaacaacatcc
aaatcgttaactgttcaagcccaagtggacttgctcatccagcaggcgttgtctcatgaa
aatctttgtcagtgctatatcggctggtgcccgttttggtga

DBGET integrated database retrieval system