KEGG   Trichinella spiralis: Tsp_04781Help
Entry
Tsp_04781         CDS       T01609                                 

Definition
(RefSeq) protein disulfide-isomerase A4
  KO
K09582  protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tsp_04781
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tsp_04781
Chaperones and folding catalysts [BR:tsp03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Tsp_04781
Membrane trafficking [BR:tsp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Tsp_04781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_2 AhpC-TSA Thioredoxin_7 Thioredoxin_8 Calsequestrin ERp29_N HyaE DUF3000
Motif
Other DBs
NCBI-GeneID: 10912642
NCBI-ProteinID: XP_003369366
UniProt: E5SW38
Position
Unknown
AA seq 614 aa AA seqDB search
MVIVWFDLHFFVPLLHFDGISKAEKFTEENNVVVLTNDNYDQFLQENSIALIEFYAHWCG
HCKKLEPEYARAAEKLKKTNVKVPLAKVDAVNEQALADRFQITGYPTLKFWNGHSYIDYD
GTNDWKGIVEWVSEKADPNYKPPPQAVITLTNDNFTDIVTNTQLMLVKFFATWCGHCKKL
APEYEKAAQRLRDQQLPILLAKVDAIVEKDLASQYQINGYPTLKIFRYGRPYDYNGPRFA
DGIVDYMEEQLKPAAGEIDNVQTALKFITNEDITLIGLFQNDQEPFYNNFVEAADELREK
IKNIAFSFDSEVKHKYSTNGRSEIILFIPEKLASPYESRKRTFQKTEASKEDILKFIYNN
CIPLVGHRTRANYQWMYKINEKPLVVAYYSVDFSYQYANDTQYWRKRIANVAKDYPKYTF
AISDEEEFQDELKEVKLDDSGLDVNVIVFGIDGRKFTLDPDEDDFSEDVFRNFMKNLNDG
RIKSFMKTQAPPKIQTGPVVTVVSSTFNKIVKDENKDVLIEMYAPWCGHCKALEPIYEEL
ARSLKSESGLVIAKMNAVDNDVDPDYPVEGFPTIYFAPKGNKKRPIKYHGERTVQALNAF
LKKHAVVSFGKAEL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgtctggtttgaccttcatttcttcgttcctctgttgcattttgatggcatt
tcgaaagcggaaaaatttacagaagaaaataacgtcgttgtattgactaatgataattat
gatcaatttttgcaagaaaattcaatagcattgattgaattttacgctcactggtgtggg
cattgtaaaaagttggaacctgagtatgcacgtgcggcagaaaagctgaagaaaaccaat
gtcaaagtgcctttggcaaaagtagatgccgtcaacgagcaggcgttggcagatcgcttt
caaatcaccggttatcctacgttgaaattttggaatggccattcatacatagactacgac
ggaactaacgactggaagggaattgtcgaatgggtttctgaaaaagccgatccgaattat
aaaccgcctccacaagcagtgatcactttgaccaatgacaattttacagatatcgttacg
aatacccaattaatgcttgtcaaattttttgcaacttggtgtggtcattgcaagaaactt
gctcctgaatatgagaaagcagctcagcgtttgcgagatcaacaactgcccattttattg
gcaaaagtggatgctattgttgaaaaagatttagcatcgcaataccagatcaacggctat
ccgactttgaagatttttcgatatggacgaccgtacgactacaatggaccacgttttgcc
gatggaattgttgattatatggaagaacagctaaagccggctgctggtgagattgataat
gttcaaacggcgctaaaattcatcaccaatgaagatatcactttgattggtttattccaa
aatgatcaagagccattttataataattttgtcgaagctgccgacgaacttcgagaaaaa
ataaaaaatattgcattcagttttgattcagaagtgaagcacaaatattccaccaacggt
cgaagtgaaataatattgtttatacctgaaaaacttgcttcaccgtatgaatcaagaaag
agaacatttcaaaaaacagaagccagtaaggaagatattttgaaattcatttataataat
tgcatacctttggttggacaccgtaccagagccaactatcagtggatgtataaaattaat
gaaaagccactggttgttgcttattattcggtagacttcagctatcaatatgcaaatgat
acccagtactggagaaaaagaatagcaaatgtggcaaaagattatccaaagtatacgttc
gcaatttctgatgaagaagaatttcaagatgaattgaaagaagtaaaactggacgattcc
ggcctggatgtcaacgttatcgttttcggtatcgacggcagaaaattcacacttgatccg
gatgaggatgatttcagtgaagatgtgttcagaaattttatgaaaaatctcaatgatggt
cgaatcaaatcattcatgaaaactcaagctccaccaaaaattcaaactggaccagtagtt
acagtagtgtcttcgacgtttaacaaaattgtaaaagatgaaaataaagatgttttaata
gaaatgtacgcaccatggtgtggtcactgcaaggcactggagcctatatatgaagaatta
gcacgttctttgaaatcagaaagtggtttagtgatcgcaaaaatgaacgctgtggacaat
gatgttgatcctgattatcctgtcgaaggctttcctaccatttattttgctccaaaagga
aacaagaaacgcccaattaaataccacggcgaacgaacagtgcaagcactaaatgcgttc
ttaaagaaacacgcagtagttagcttcggaaaagcagaattatga

DBGET integrated database retrieval system