KEGG   Trichinella spiralis: Tsp_04781Help
Entry
Tsp_04781         CDS       T01609                                 

Definition
protein disulfide-isomerase A4
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
tsp  Trichinella spiralis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tsp_04781
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tsp_04781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 614 aa AA seqDB search
MVIVWFDLHFFVPLLHFDGISKAEKFTEENNVVVLTNDNYDQFLQENSIALIEFYAHWCG
HCKKLEPEYARAAEKLKKTNVKVPLAKVDAVNEQALADRFQITGYPTLKFWNGHSYIDYD
GTNDWKGIVEWVSEKADPNYKPPPQAVITLTNDNFTDIVTNTQLMLVKFFATWCGHCKKL
APEYEKAAQRLRDQQLPILLAKVDAIVEKDLASQYQINGYPTLKIFRYGRPYDYNGPRFA
DGIVDYMEEQLKPAAGEIDNVQTALKFITNEDITLIGLFQNDQEPFYNNFVEAADELREK
IKNIAFSFDSEVKHKYSTNGRSEIILFIPEKLASPYESRKRTFQKTEASKEDILKFIYNN
CIPLVGHRTRANYQWMYKINEKPLVVAYYSVDFSYQYANDTQYWRKRIANVAKDYPKYTF
AISDEEEFQDELKEVKLDDSGLDVNVIVFGIDGRKFTLDPDEDDFSEDVFRNFMKNLNDG
RIKSFMKTQAPPKIQTGPVVTVVSSTFNKIVKDENKDVLIEMYAPWCGHCKALEPIYEEL
ARSLKSESGLVIAKMNAVDNDVDPDYPVEGFPTIYFAPKGNKKRPIKYHGERTVQALNAF
LKKHAVVSFGKAEL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgtctggtttgaccttcatttcttcgttcctctgttgcattttgatggcatt
tcgaaagcggaaaaatttacagaagaaaataacgtcgttgtattgactaatgataattat
gatcaatttttgcaagaaaattcaatagcattgattgaattttacgctcactggtgtggg
cattgtaaaaagttggaacctgagtatgcacgtgcggcagaaaagctgaagaaaaccaat
gtcaaagtgcctttggcaaaagtagatgccgtcaacgagcaggcgttggcagatcgcttt
caaatcaccggttatcctacgttgaaattttggaatggccattcatacatagactacgac
ggaactaacgactggaagggaattgtcgaatgggtttctgaaaaagccgatccgaattat
aaaccgcctccacaagcagtgatcactttgaccaatgacaattttacagatatcgttacg
aatacccaattaatgcttgtcaaattttttgcaacttggtgtggtcattgcaagaaactt
gctcctgaatatgagaaagcagctcagcgtttgcgagatcaacaactgcccattttattg
gcaaaagtggatgctattgttgaaaaagatttagcatcgcaataccagatcaacggctat
ccgactttgaagatttttcgatatggacgaccgtacgactacaatggaccacgttttgcc
gatggaattgttgattatatggaagaacagctaaagccggctgctggtgagattgataat
gttcaaacggcgctaaaattcatcaccaatgaagatatcactttgattggtttattccaa
aatgatcaagagccattttataataattttgtcgaagctgccgacgaacttcgagaaaaa
ataaaaaatattgcattcagttttgattcagaagtgaagcacaaatattccaccaacggt
cgaagtgaaataatattgtttatacctgaaaaacttgcttcaccgtatgaatcaagaaag
agaacatttcaaaaaacagaagccagtaaggaagatattttgaaattcatttataataat
tgcatacctttggttggacaccgtaccagagccaactatcagtggatgtataaaattaat
gaaaagccactggttgttgcttattattcggtagacttcagctatcaatatgcaaatgat
acccagtactggagaaaaagaatagcaaatgtggcaaaagattatccaaagtatacgttc
gcaatttctgatgaagaagaatttcaagatgaattgaaagaagtaaaactggacgattcc
ggcctggatgtcaacgttatcgttttcggtatcgacggcagaaaattcacacttgatccg
gatgaggatgatttcagtgaagatgtgttcagaaattttatgaaaaatctcaatgatggt
cgaatcaaatcattcatgaaaactcaagctccaccaaaaattcaaactggaccagtagtt
acagtagtgtcttcgacgtttaacaaaattgtaaaagatgaaaataaagatgttttaata
gaaatgtacgcaccatggtgtggtcactgcaaggcactggagcctatatatgaagaatta
gcacgttctttgaaatcagaaagtggtttagtgatcgcaaaaatgaacgctgtggacaat
gatgttgatcctgattatcctgtcgaaggctttcctaccatttattttgctccaaaagga
aacaagaaacgcccaattaaataccacggcgaacgaacagtgcaagcactaaatgcgttc
ttaaagaaacacgcagtagttagcttcggaaaagcagaattatga

DBGET integrated database retrieval system