KEGG   Trichinella spiralis: Tsp_04892Help
Entry
Tsp_04892         CDS       T01609                                 

Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
tsp  Trichinella spiralis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tsp_04892
  Lipid metabolism
   00600 Sphingolipid metabolism
    Tsp_04892
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Tsp_04892
   00604 Glycosphingolipid biosynthesis - ganglio series
    Tsp_04892
   00511 Other glycan degradation
    Tsp_04892
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Tsp_04892
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tsp_04892
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tsp_04892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 585 aa AA seqDB search
MHCVLVLIKVRAAGLNAIQTYVPWNLHEPLPGEYYFDGMANLPVFLQTAQQLGLDVILRP
GPYICAEWENGGLPWWLLNIPNLKPRTSDGRFLNFVQRWFAELFSIVVPFLYKNGGPIIS
IQVENEYGSFPACDRNYMSELYHMIRAYAGEDTVLFTVDGNAVGLLRCGHVPGAHATVDF
GPSTLKEVEQAFAVQRFYAPRGPLVNSEFYPGWFDVWGKNHSRTQISPIVDSMAYMWYMN
ASFSMYVFHGGTNFGFMNCANGAGPLPVTTGYDYDAPLTEAGDLTPKYLAIREQIQHLTG
YAIPYPLPASTDKAAYGSLTVHALGKVTELLDLISPVHRRRISNQPLPFETIGIGYGYVL
YETRVPFHSTAGQYVLRAQGVRDRAYVMIDGQVQAILNSLTHHFRAKLHASVGQHLQILV
ENLGRQCSGHPDPKGILGSVTLDGQTLFNWTNYPIQPQLLFQFNLPVSTLSTRIPKSNPR
PRHHTYTPTIYASEFRLENPTADTFFHPKHWAKGQMYMNEINVGRYWPAAGPQMTLYVPK
NFLKPGTNRIVIFEFESAGCCSQNNSDTCTVEFIDFPLYKPAKNI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtgttcttgtactgatcaaagtgagagcagcaggcctgaacgctatacaaact
tatgttccttggaatcttcacgaaccactgcctggggaatactatttcgacggaatggcc
aatttgccagttttcctgcaaacagcgcaacagttgggcttggacgtgatcctccgccca
ggaccgtacatttgcgctgaatgggaaaacggtggtctaccttggtggttgttgaacata
ccgaatttgaagccacgtacgtcggatggtcgatttctgaacttcgttcagcgttggttt
gccgaactgttcagcattgtggtaccttttctgtacaaaaatgggggtccaattatcagc
atacaagtggaaaacgagtatggaagttttccagcctgcgaccgcaattacatgtccgaa
ttgtaccacatgattcgtgcctacgctggagaagatacagttctattcacagtcgacgga
aatgccgtaggtttgctgaggtgtggtcatgtgccaggcgctcacgcgacggtcgatttc
ggaccgtcaacgttgaaagaagttgaacaagcgtttgcggtgcagcgcttctacgcacct
cggggaccgttggtgaacagcgaattctatccgggctggttcgacgtctggggcaagaac
cattcgcggacgcaaatttcgcccatcgttgacagcatggcctacatgtggtacatgaac
gcctcgttcagcatgtacgttttccacggcggcaccaatttcggcttcatgaactgcgcc
aacggagcgggaccgttgccggtgaccaccggctacgactacgacgcaccgttgactgaa
gccggcgatttgacgcccaaatatctggcaatacgtgaacaaatacaacacttgaccggc
tacgcaataccgtatccgttgccggcttcgactgacaaagctgcatacggttcgttgacg
gtccacgccctgggcaaggtgaccgaactgctcgacctgatttcaccggttcacaggcga
cgcatctccaaccaaccgttgccgttcgagacgatcggcatcggctacggctacgtactg
tacgagaccagggtgccgttccacagcaccgccggccagtacgttcttcgtgctcagggt
gtccgagaccgagcatacgtgatgattgacggccaagtgcaagcaatactgaactcactg
acgcaccattttcgagccaaactgcacgccagcgttggacaacatttgcagattttggtc
gaaaatctcggccgccagtgttccggtcatccggatccgaaaggcattctcggaagcgtc
accttggacggtcagacgttgttcaactggaccaattatccaattcaaccccaactgctt
ttccaattcaacttgccagtgtcgacgttgtcaacaaggattccaaaatccaatcccaga
ccccgacaccacacctacaccccaactatttacgcgtcggaatttcgactggaaaatccc
accgcggacactttcttccacccgaaacactgggccaaaggacagatgtacatgaacgaa
atcaacgtcggtcgctattggccagccgctggaccccagatgacactgtacgtgccgaaa
aattttctcaaaccaggaacaaacagaatcgtaatttttgaattcgaatccgccggctgt
tgttcgcaaaacaactccgacacgtgcactgtagaatttatcgactttccactgtacaaa
cctgcaaaaaatatctaa

DBGET integrated database retrieval system