KEGG   Trichinella spiralis: Tsp_04892Help
Entry
Tsp_04892         CDS       T01609                                 

Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
tsp  Trichinella spiralis
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tsp00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tsp00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:tsp00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:tsp00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tsp00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tsp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 585 aa AA seqDB search
MHCVLVLIKVRAAGLNAIQTYVPWNLHEPLPGEYYFDGMANLPVFLQTAQQLGLDVILRP
GPYICAEWENGGLPWWLLNIPNLKPRTSDGRFLNFVQRWFAELFSIVVPFLYKNGGPIIS
IQVENEYGSFPACDRNYMSELYHMIRAYAGEDTVLFTVDGNAVGLLRCGHVPGAHATVDF
GPSTLKEVEQAFAVQRFYAPRGPLVNSEFYPGWFDVWGKNHSRTQISPIVDSMAYMWYMN
ASFSMYVFHGGTNFGFMNCANGAGPLPVTTGYDYDAPLTEAGDLTPKYLAIREQIQHLTG
YAIPYPLPASTDKAAYGSLTVHALGKVTELLDLISPVHRRRISNQPLPFETIGIGYGYVL
YETRVPFHSTAGQYVLRAQGVRDRAYVMIDGQVQAILNSLTHHFRAKLHASVGQHLQILV
ENLGRQCSGHPDPKGILGSVTLDGQTLFNWTNYPIQPQLLFQFNLPVSTLSTRIPKSNPR
PRHHTYTPTIYASEFRLENPTADTFFHPKHWAKGQMYMNEINVGRYWPAAGPQMTLYVPK
NFLKPGTNRIVIFEFESAGCCSQNNSDTCTVEFIDFPLYKPAKNI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtgttcttgtactgatcaaagtgagagcagcaggcctgaacgctatacaaact
tatgttccttggaatcttcacgaaccactgcctggggaatactatttcgacggaatggcc
aatttgccagttttcctgcaaacagcgcaacagttgggcttggacgtgatcctccgccca
ggaccgtacatttgcgctgaatgggaaaacggtggtctaccttggtggttgttgaacata
ccgaatttgaagccacgtacgtcggatggtcgatttctgaacttcgttcagcgttggttt
gccgaactgttcagcattgtggtaccttttctgtacaaaaatgggggtccaattatcagc
atacaagtggaaaacgagtatggaagttttccagcctgcgaccgcaattacatgtccgaa
ttgtaccacatgattcgtgcctacgctggagaagatacagttctattcacagtcgacgga
aatgccgtaggtttgctgaggtgtggtcatgtgccaggcgctcacgcgacggtcgatttc
ggaccgtcaacgttgaaagaagttgaacaagcgtttgcggtgcagcgcttctacgcacct
cggggaccgttggtgaacagcgaattctatccgggctggttcgacgtctggggcaagaac
cattcgcggacgcaaatttcgcccatcgttgacagcatggcctacatgtggtacatgaac
gcctcgttcagcatgtacgttttccacggcggcaccaatttcggcttcatgaactgcgcc
aacggagcgggaccgttgccggtgaccaccggctacgactacgacgcaccgttgactgaa
gccggcgatttgacgcccaaatatctggcaatacgtgaacaaatacaacacttgaccggc
tacgcaataccgtatccgttgccggcttcgactgacaaagctgcatacggttcgttgacg
gtccacgccctgggcaaggtgaccgaactgctcgacctgatttcaccggttcacaggcga
cgcatctccaaccaaccgttgccgttcgagacgatcggcatcggctacggctacgtactg
tacgagaccagggtgccgttccacagcaccgccggccagtacgttcttcgtgctcagggt
gtccgagaccgagcatacgtgatgattgacggccaagtgcaagcaatactgaactcactg
acgcaccattttcgagccaaactgcacgccagcgttggacaacatttgcagattttggtc
gaaaatctcggccgccagtgttccggtcatccggatccgaaaggcattctcggaagcgtc
accttggacggtcagacgttgttcaactggaccaattatccaattcaaccccaactgctt
ttccaattcaacttgccagtgtcgacgttgtcaacaaggattccaaaatccaatcccaga
ccccgacaccacacctacaccccaactatttacgcgtcggaatttcgactggaaaatccc
accgcggacactttcttccacccgaaacactgggccaaaggacagatgtacatgaacgaa
atcaacgtcggtcgctattggccagccgctggaccccagatgacactgtacgtgccgaaa
aattttctcaaaccaggaacaaacagaatcgtaatttttgaattcgaatccgccggctgt
tgttcgcaaaacaactccgacacgtgcactgtagaatttatcgactttccactgtacaaa
cctgcaaaaaatatctaa

DBGET integrated database retrieval system