KEGG   Trichinella spiralis: Tsp_04914Help
Entry
Tsp_04914         CDS       T01609                                 

Definition
serine/threonine-protein kinase mos
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tsp04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 416 aa AA seqDB search
MTKLPSPLVQHCIFEPRKNDFRSEIHCCATAPKCQNGSVTPIRRPDWTDEAENEEILLCR
SKNNETSVNRQLSRFYSPILPSKTLFPVQEKNSQSAQTAAEIAVVRRHSILFSHNRKHQW
KKRKFRARKLYQNTEDISNHENNKNKNYLQVTTSSHQLLGQGGFGAVYIGILAGKLVAIK
QLHKTIKEKLVENSFCAEMNMFGLDHPNIVKILTFSSLEAEIEIVYEYVSKKNLQQLIHD
SEIEIEPMKKVKFCRQIADALQYCHKNNILHLDVKPSNVLISCDGNDCKLTDFGCSRRIH
HDQLNVEGNTLNLGQSGTLIYKCPELLRGQQPTIKADVYSYGLLLWECVMRQIPFGGINQ
HTVVFCVVAKQLRPYVNNFVRSEEETKLLRLAKICWEAEPENRPNFPQICHFFTKF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattgccatcgcctttagtccaacattgcatatttgaaccaagaaaaaatgat
tttcgaagtgaaattcattgttgtgcaactgcaccgaaatgccaaaacggttcagtaaca
ccaattcgaagaccagattggacagatgaagctgaaaatgaagaaattctattgtgcaga
tcaaaaaataacgaaacctcagtcaatcgacaattaagccgtttctattcaccaattttg
ccttcaaaaacactttttccagtacaagaaaaaaattcccaaagtgcacagacagctgct
gaaatagctgtagtacgacgtcatagtatacttttttcgcataacagaaaacatcaatgg
aagaaaaggaaatttcgcgcaagaaagctctatcaaaacactgaagatatttctaatcat
gagaataataaaaataaaaattatctacaagttactacatcatcacaccagcttcttggc
cagggtggctttggtgcagtttatattggtatattagccggtaaattagttgcaataaag
caactgcacaaaacaattaaagagaaactagtggaaaacagtttctgtgcagaaatgaat
atgtttggtctggatcatcccaatattgtaaaaatattaacattttcatctttagaagcg
gaaattgaaattgtctatgaatatgttagtaagaagaatttacagcaacttattcatgat
tcagaaatagaaatagaaccaatgaaaaaagtgaaattttgtcgtcaaattgctgacgct
ctccaatattgtcataaaaataatattttacacttggatgtgaaaccatcaaacgtatta
atcagttgcgatggcaatgactgcaaattaacagattttggttgtagccgaagaattcac
catgatcaacttaatgtggaaggtaatactttaaatcttggacaatctggaaccctaata
tacaaatgtcctgaactgcttcgaggtcaacaaccaaccatcaaagctgatgtatattct
tatggccttttactgtgggaatgtgtaatgagacaaattcctttcggtggaataaatcaa
catacggtagtgttttgcgttgtagcgaaacaactccgcccatacgtaaataattttgtt
cgttctgaagaagaaacaaaacttcttcgtctggcaaaaatatgctgggaagctgagcct
gaaaatcgacccaactttcctcaaatttgtcacttttttactaaattctaa

DBGET integrated database retrieval system