KEGG   Trichinella spiralis: Tsp_04914Help
Entry
Tsp_04914         CDS       T01609                                 

Definition
serine/threonine-protein kinase mos
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_04914
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tsp_04914
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: Other group
  MOS family
   Tsp_04914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 416 aa AA seqDB search
MTKLPSPLVQHCIFEPRKNDFRSEIHCCATAPKCQNGSVTPIRRPDWTDEAENEEILLCR
SKNNETSVNRQLSRFYSPILPSKTLFPVQEKNSQSAQTAAEIAVVRRHSILFSHNRKHQW
KKRKFRARKLYQNTEDISNHENNKNKNYLQVTTSSHQLLGQGGFGAVYIGILAGKLVAIK
QLHKTIKEKLVENSFCAEMNMFGLDHPNIVKILTFSSLEAEIEIVYEYVSKKNLQQLIHD
SEIEIEPMKKVKFCRQIADALQYCHKNNILHLDVKPSNVLISCDGNDCKLTDFGCSRRIH
HDQLNVEGNTLNLGQSGTLIYKCPELLRGQQPTIKADVYSYGLLLWECVMRQIPFGGINQ
HTVVFCVVAKQLRPYVNNFVRSEEETKLLRLAKICWEAEPENRPNFPQICHFFTKF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattgccatcgcctttagtccaacattgcatatttgaaccaagaaaaaatgat
tttcgaagtgaaattcattgttgtgcaactgcaccgaaatgccaaaacggttcagtaaca
ccaattcgaagaccagattggacagatgaagctgaaaatgaagaaattctattgtgcaga
tcaaaaaataacgaaacctcagtcaatcgacaattaagccgtttctattcaccaattttg
ccttcaaaaacactttttccagtacaagaaaaaaattcccaaagtgcacagacagctgct
gaaatagctgtagtacgacgtcatagtatacttttttcgcataacagaaaacatcaatgg
aagaaaaggaaatttcgcgcaagaaagctctatcaaaacactgaagatatttctaatcat
gagaataataaaaataaaaattatctacaagttactacatcatcacaccagcttcttggc
cagggtggctttggtgcagtttatattggtatattagccggtaaattagttgcaataaag
caactgcacaaaacaattaaagagaaactagtggaaaacagtttctgtgcagaaatgaat
atgtttggtctggatcatcccaatattgtaaaaatattaacattttcatctttagaagcg
gaaattgaaattgtctatgaatatgttagtaagaagaatttacagcaacttattcatgat
tcagaaatagaaatagaaccaatgaaaaaagtgaaattttgtcgtcaaattgctgacgct
ctccaatattgtcataaaaataatattttacacttggatgtgaaaccatcaaacgtatta
atcagttgcgatggcaatgactgcaaattaacagattttggttgtagccgaagaattcac
catgatcaacttaatgtggaaggtaatactttaaatcttggacaatctggaaccctaata
tacaaatgtcctgaactgcttcgaggtcaacaaccaaccatcaaagctgatgtatattct
tatggccttttactgtgggaatgtgtaatgagacaaattcctttcggtggaataaatcaa
catacggtagtgttttgcgttgtagcgaaacaactccgcccatacgtaaataattttgtt
cgttctgaagaagaaacaaaacttcttcgtctggcaaaaatatgctgggaagctgagcct
gaaaatcgacccaactttcctcaaatttgtcacttttttactaaattctaa

DBGET integrated database retrieval system