KEGG   Trichinella spiralis: Tsp_05005Help
Entry
Tsp_05005         CDS       T01609                                 

Definition
putative 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon-1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
tsp  Trichinella spiralis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tsp_05005
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    Tsp_05005
   04070 Phosphatidylinositol signaling system
    Tsp_05005
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Tsp_05005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1120 aa AA seqDB search
MITVVKISPKINIFLRYASELNSVYLSTLGTVCELFKMIHVCSGQLRGNSIISKKPQENS
ELGFSSRVRLSIRNSFRLHSSVQHNSSQPAYLSPKTTLTTSSKAKSLEDTDRMKSPFPTV
TSPSASYKQSTGDIQENPLTFLEFVELFKLFSIRMRKDLLMQTMTFLMELLPMKLHLTTG
GWKVYSQLYSHNSVNLTTLPTINICICQHLEYKNDFMRLSDLPVKVADKQMKIYDALATS
SIGQNSAGVDTSRSVWLTPAALKAFMLNHQMEVISDEEAENLINRHETDPIMRSKQRMSF
EGFARLLLDKSNFAYLNEENRPIMKDMNFPLSYYYIASSHNTYLTGHQLKGESSVELYRQ
ILLTGCRCIELDCWDGDDGQPVIYHGHTLTTKIDFKQVVEIIHKSAFEASSLPVIISIEN
HCSLLQQTKMAQTFKAVFGDNLVSQFMFETDNLETPRLPSPLQLKKKILIKNKKLSFEPM
QPLSDRSSKLEMQKAQKSSLIDWSIEDEDDDEGNYEFDEMIDEEEDDDQNRYSAQTDSAS
SKLLPFSKLQAKKGSVKSKDDSYSSDASSVKNEQAANAITIATCSGSELTASVEELWKPN
SKKSGTSAPQVAPELSDLVIYCQAVKFKGFTFTTDSEFSQKRIAYSVSKKQSLTVQPALP
SPIVDSSTGESSFPLSGRRSAPVHISCYQLPSMNETAAKKLTRKHPRKILAFTKDHILRT
YPSAVRIDSSNFNPLTFWTFGIQMVALNYQTQDIPMAVNTAMFEQNGNCGFMLKPRVMWD
DSHPLYDSFNPWARDLREISGLRLTLVIISGQFVCPGQSDASPLVEIELMGIVADCSKEK
TKVIQRNALNPIWNQSFQFRVNFLDLCFLRLSVIESGNNKCTAQRIIPLKMLRAGYRHVR
LRSPINTALEYSTLFIYSRMEEEEFIYLDDDAVENKLHSFPQNEVEIPIFKQQIYVLQIH
GVLPDNGFTVVHAQSSTTVHEVIEMALKNANRENDPPDDYVLMEELASHKRSEDEKGNEQ
IRQRVLNPNNSVLNAVANWNGAKGRFVIRKKGSDPSSRAWMTTMIKSSKEMLPNQSPHVS
ETSETTFLVCVHNVSGDQAYAILRASVKSAAKDIIKQSLQ
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgataacagtagtaaaaatatctcctaaaataaatatttttctacgttacgcatcagaa
ttaaattcagtgtatctttcaacattaggcactgtatgtgaactttttaagatgatacat
gtatgcagtggtcaactacggggaaactcgattatatccaagaaaccacaagaaaattct
gagctgggtttttcttctcgcgttcgacttagtattcgaaattcattccgccttcactca
tccgtacaacacaattcttcacaacctgcatatttatcaccaaaaactacacttactaca
tcgagcaaagccaaaagtctcgaagacaccgatcgcatgaaatctccatttccaactgtt
acttcaccttcagcgtcttataaacaatccactggagatattcaagaaaatccgctaaca
tttttggaatttgtagaactgtttaaactgttttcaattcgcatgcggaaggatttacta
atgcaaacaatgacttttctgatggaattgctgccaatgaaacttcacttaacaactggt
gggtggaaagtttacagtcagctgtatagccataacagtgtaaatttaacaactttgccc
acaattaatatatgcatatgccagcatctagagtataaaaatgattttatgcgcctctca
gatttaccggtcaaagttgccgataagcaaatgaaaatatacgatgcattagctacatct
agcataggacaaaattcagcaggagttgatacttctagaagtgtttggctgactccggct
gcattgaaagcttttatgcttaatcatcagatggaagtgattagtgatgaagaagcagaa
aatttaataaatcgtcatgaaacggatccaatcatgcgctcaaagcaaagaatgtcgttt
gagggttttgcaagattacttttagataaatctaattttgcttatttgaatgaagaaaat
agacctatcatgaaagatatgaattttcctttatcgtattattatattgcttcatcacac
aatacatatcttacgggtcatcagttaaaaggagaatcaagtgttgaactgtatcgacaa
attttgctgacaggttgtcgctgtattgaacttgactgctgggacggagatgacggtcaa
cctgtcatctatcatggtcataccttgactactaagattgattttaagcaagtagtagaa
attattcacaaaagtgcatttgaagcatcatcacttccggttattattagcatagaaaat
cattgctcattgcttcaacagacaaagatggctcaaacgtttaaagcggttttcggtgac
aatctcgtatcccagtttatgtttgaaactgacaacttggaaacccctcgcttaccgtct
ccattacaacttaagaaaaaaattttgattaaaaacaaaaagctctcttttgaacctatg
caaccacttagtgatcgttcttcgaaactggaaatgcaaaaagctcaaaagagttcactt
attgactggagcattgaagatgaagatgacgatgaaggaaattatgagtttgacgagatg
attgatgaagaagaagatgatgatcaaaaccgatattctgctcaaacagattctgccagt
agtaaattgttaccgttctcgaaacttcaagcgaagaaaggttcagtgaagtcaaaagat
gacagctattccagtgatgctagctcagtaaaaaatgagcaagcagccaatgcaataacc
atagcaacgtgtagtggtagcgagttaacagcttcagttgaagaactgtggaaaccaaat
tcaaaaaagtcaggcacttctgcacctcaagttgcgcctgagctaagcgatcttgtcata
tattgccaagctgtaaaatttaaaggattcacattcactacagattcagaattttctcaa
aaaagaattgcctacagtgttagcaaaaagcaaagcctcactgtacagcctgcactacca
agtccaattgtggacagtagcactggtgaaagtagttttccattgagcggtagaagaagt
gcaccggttcacatttcttgctatcagttgccttcaatgaatgagacagctgcaaaaaaa
ctgaccaggaaacatccgcgaaaaatacttgcatttaccaaagatcacattttacgcact
tatccttccgctgtgagaatcgattcatcaaactttaatcctctcacgttttggactttt
ggaatacaaatggttgcccttaattatcaaactcaagacattccgatggcagtaaacact
gccatgtttgaacagaatggtaactgtggctttatgctcaagccaagggtaatgtgggat
gattcacatccgctgtatgacagttttaatccatgggcacgtgacctcagggaaattagt
ggtctgcggcttacactggtcatcatttctggccagtttgtttgccctggacaaagtgat
gctagcccgttggtggaaattgaattgatgggaattgttgcggattgttcaaaggaaaag
acaaaagtcatccaacgcaacgctctaaatccaatatggaatcaatcatttcaattcagg
gttaattttttggatctctgctttcttcgcttatccgtaattgaatcgggtaacaacaag
tgcaccgctcagcgcatcattcctttgaaaatgctccgtgctggctatcgccacgttcga
cttcgttctccaatcaacactgctcttgaatattcgacattgttcatttactcaagaatg
gaagaagaagaatttatttatctcgacgatgatgcggtggaaaataaactgcacagtttt
ccacaaaatgaagttgagatccccatttttaagcagcaaatatatgtgttacaaattcac
ggtgtactgcctgataatggtttcacagttgtgcacgcacaaagttcaacaactgttcac
gaagttattgaaatggctttgaaaaatgctaatcgagaaaatgatcctccggatgattat
gttttgatggaagagcttgctagtcacaaaagatcagaggatgaaaaaggcaatgagcaa
attcgtcaaagagtgctgaatccaaacaattcagttttaaatgctgttgcaaattggaat
ggagccaagggacgctttgttattcgcaagaaaggaagcgatcctagcagtcgagcttgg
atgaccactatgatcaaatccagtaaagaaatgttgcccaaccagtcaccacatgtttct
gaaacttcggagacaacatttttagtctgcgttcataacgtttctggtgatcaagcgtac
gcaattttaagagcttctgtgaaaagtgctgccaaagatataatcaaacagtctctacag
taa

DBGET integrated database retrieval system