KEGG   Trichinella spiralis: Tsp_05023Help
Entry
Tsp_05023         CDS       T01609                                 

Definition
histone acetyltransferase HTATIP
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Tsp_05023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 381 aa AA seqDB search
MSKQIIGKRFYVQMSEQSEWHVAEILSSKVKDDQTYYYVHYVDFNRRLDEWIPMERIDFT
KPVETNRSSVNSSQKEKSKANGSNKQKALQVKSETNGDAESACVPRGSMRHSIDDNLTPK
IRNVEQILLGHYRIQPWYFSPYPQELCQLPCIYLCPFCLKYVKSMDCLKRHAVCILLLIN
GMQKCPWRHPPGVEIYRKDKLSVFEVDGRKSKTYAENLCLLAKLFLDHKTLYYDTEPFLF
YVFTEMDKFGCHIVGYFSKEKISTEHFNLACILVLPPFQRKGYGSLMIEFSYALSRIEKK
TGTPEKPLSDLGMLSYRSYWDQTIAEIVYLKAMRFYNGQHILVVSEELKNNLRRMMSKRK
LTVDVSRIQWKPKDWIKRRMG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacaaatcattggaaaacgattttacgttcagatgagtgaacagtctgaatgg
catgtggccgagatattgtcgtcgaaagtaaaagatgatcaaacgtattattatgtacat
tatgtggacttcaaccgtcgactagacgaatggattcccatggaacgcattgattttacg
aaaccggtggaaacgaaccgttcatctgttaattcttcacaaaaagagaaatctaaagca
aacggatcaaataagcagaaagcattgcaagtgaaatctgaaacaaatggagatgcggaa
tctgcttgtgtccctcgtggatcgatgcgccattcgattgatgataatttaacaccgaaa
atcagaaatgttgaacagattctacttggtcattatcgaatacaaccatggtacttttct
ccatatcctcaggagctttgtcagttgccctgcatttatttatgcccattttgtctgaag
tacgtgaaatcgatggattgtttgaaacgccacgcagtatgcattttgcttctgataaac
ggtatgcaaaaatgtccttggcgtcatcctccaggagtggaaatttatcgcaaagataag
ttatccgtttttgaagttgatggacgcaaatcaaaaacgtatgcagagaatttgtgcttg
ctagccaagttgtttttggatcacaaaacactttattatgacacggaaccatttttgttt
tacgtctttactgaaatggataaatttggttgtcacatcgtgggttatttttcaaaggag
aagatatcgacggaacatttcaatttggcttgtattcttgtgttgcctccttttcagcgc
aaaggttatggttcattgatgattgaattcagctatgctttgtcccgcatagagaagaaa
acaggcacaccggagaagcccttatctgatttgggtatgctttcatatcgaagctattgg
gatcaaacgatagctgaaattgtatatttgaaagcaatgcgattttacaatggacagcac
attctggtagtgtctgaagaactgaagaataatttgcgtcgaatgatgtcaaaaaggaag
ctgacagtggatgtgtcgcgcattcagtggaaaccgaaagactggataaaacgacgaatg
ggatga

DBGET integrated database retrieval system