KEGG   Trichinella spiralis: Tsp_05191Help
Entry
Tsp_05191         CDS       T01609                                 

Definition
(RefSeq) replication protein A subunit
  KO
K10739  replication factor A2
Organism
tsp  Trichinella spiralis
Pathway
tsp03030  DNA replication
tsp03420  Nucleotide excision repair
tsp03430  Mismatch repair
tsp03440  Homologous recombination
tsp03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tsp_05191
   03420 Nucleotide excision repair
    Tsp_05191
   03430 Mismatch repair
    Tsp_05191
   03440 Homologous recombination
    Tsp_05191
   03460 Fanconi anemia pathway
    Tsp_05191
DNA replication proteins [BR:tsp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Tsp_05191
DNA repair and recombination proteins [BR:tsp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Tsp_05191
   MMR (mismatch exicision repair)
     Tsp_05191
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Tsp_05191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C
Motif
Other DBs
NCBI-GeneID: 10908931
NCBI-ProteinID: XP_003369781
UniProt: E5SXA3
Position
Unknown
AA seq 279 aa AA seqDB search
MDQSFDGGVGGFLASQSGDRPEIRKSQREIVPVTCSMINNMSPGEDNLRIGTYEVSQVCI
VAVIRDVSYGDIYTDITIDDMTSSPITARQWVKVHSIYVVKVVTIQYLAVICIVKENKNT
EEMQKKCNSLVKVFGNITTFQKKKILTVFGMMTVADLNDLTVHLLEVLRAKLSFEKDCLN
TDRKESNRPKDATPFMSYGTSEMQADNKMTYDNGLSGLRAEIYRFLSNNDTIEGCSVNDI
KSHFAHVTMSKLRDEIEFLCCEGHIYSTIDEDHFKASDE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatcatttgatggtggtgttggtggatttctggcaagtcaaagtggcgatagg
cctgaaataagaaagagtcaaagagagatagtcccagtgacttgtagtatgataaacaac
atgtcacctggagaagataatttgagaattggcacatatgaagtttcgcaggtttgtatt
gtggctgttattagagacgtatcttacggtgacatctatactgacatcacaattgatgat
atgacttcttctcctattactgcgagacagtgggtgaaggtacattcaatttacgtagtg
aaggtagttacaatacagtatttagctgtaatttgcattgttaaggaaaacaaaaataca
gaagaaatgcagaaaaaatgcaattcacttgttaaagtttttggtaatattaccactttt
caaaaaaagaaaattttgacggtatttgggatgatgacggtggcagatttgaatgacttg
acagtgcacttgcttgaagtgttgcgagcaaagctttcttttgaaaaggattgtttaaac
actgatagaaaagagtcgaatcgaccaaaagatgctaccccttttatgtcttacggtact
tctgaaatgcaagcggacaacaaaatgacttatgacaatggattgtctggtcttagagcg
gagatttatcgattcttgagcaacaatgatacaatcgaaggatgcagtgtgaatgatata
aagtcacattttgcacacgtcactatgagcaagttgagagatgaaattgaatttttgtgc
tgcgaaggccacatttattctaccattgatgaagatcattttaaagcatctgacgaatga

DBGET integrated database retrieval system