KEGG   Trichinella spiralis: Tsp_05191Help
Entry
Tsp_05191         CDS       T01609                                 

Definition
(RefSeq) replication protein A subunit
  KO
K10739  
replication factor A2
Organism
tsp  Trichinella spiralis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tsp_05191
   03420 Nucleotide excision repair
    Tsp_05191
   03430 Mismatch repair
    Tsp_05191
   03440 Homologous recombination
    Tsp_05191
   03460 Fanconi anemia pathway
    Tsp_05191
DNA replication proteins [BR:tsp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Tsp_05191
DNA repair and recombination proteins [BR:tsp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Tsp_05191
   MMR (mismatch exicision repair)
     Tsp_05191
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Tsp_05191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 279 aa AA seqDB search
MDQSFDGGVGGFLASQSGDRPEIRKSQREIVPVTCSMINNMSPGEDNLRIGTYEVSQVCI
VAVIRDVSYGDIYTDITIDDMTSSPITARQWVKVHSIYVVKVVTIQYLAVICIVKENKNT
EEMQKKCNSLVKVFGNITTFQKKKILTVFGMMTVADLNDLTVHLLEVLRAKLSFEKDCLN
TDRKESNRPKDATPFMSYGTSEMQADNKMTYDNGLSGLRAEIYRFLSNNDTIEGCSVNDI
KSHFAHVTMSKLRDEIEFLCCEGHIYSTIDEDHFKASDE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatcatttgatggtggtgttggtggatttctggcaagtcaaagtggcgatagg
cctgaaataagaaagagtcaaagagagatagtcccagtgacttgtagtatgataaacaac
atgtcacctggagaagataatttgagaattggcacatatgaagtttcgcaggtttgtatt
gtggctgttattagagacgtatcttacggtgacatctatactgacatcacaattgatgat
atgacttcttctcctattactgcgagacagtgggtgaaggtacattcaatttacgtagtg
aaggtagttacaatacagtatttagctgtaatttgcattgttaaggaaaacaaaaataca
gaagaaatgcagaaaaaatgcaattcacttgttaaagtttttggtaatattaccactttt
caaaaaaagaaaattttgacggtatttgggatgatgacggtggcagatttgaatgacttg
acagtgcacttgcttgaagtgttgcgagcaaagctttcttttgaaaaggattgtttaaac
actgatagaaaagagtcgaatcgaccaaaagatgctaccccttttatgtcttacggtact
tctgaaatgcaagcggacaacaaaatgacttatgacaatggattgtctggtcttagagcg
gagatttatcgattcttgagcaacaatgatacaatcgaaggatgcagtgtgaatgatata
aagtcacattttgcacacgtcactatgagcaagttgagagatgaaattgaatttttgtgc
tgcgaaggccacatttattctaccattgatgaagatcattttaaagcatctgacgaatga

DBGET integrated database retrieval system