KEGG   Trichinella spiralis: Tsp_05191Help
Entry
Tsp_05191         CDS       T01609                                 

Definition
replication protein A subunit
Orthology
K10739  
replication factor A2
Organism
tsp  Trichinella spiralis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tsp_05191
   03420 Nucleotide excision repair
    Tsp_05191
   03430 Mismatch repair
    Tsp_05191
   03440 Homologous recombination
    Tsp_05191
   03460 Fanconi anemia pathway
    Tsp_05191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 279 aa AA seqDB search
MDQSFDGGVGGFLASQSGDRPEIRKSQREIVPVTCSMINNMSPGEDNLRIGTYEVSQVCI
VAVIRDVSYGDIYTDITIDDMTSSPITARQWVKVHSIYVVKVVTIQYLAVICIVKENKNT
EEMQKKCNSLVKVFGNITTFQKKKILTVFGMMTVADLNDLTVHLLEVLRAKLSFEKDCLN
TDRKESNRPKDATPFMSYGTSEMQADNKMTYDNGLSGLRAEIYRFLSNNDTIEGCSVNDI
KSHFAHVTMSKLRDEIEFLCCEGHIYSTIDEDHFKASDE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatcatttgatggtggtgttggtggatttctggcaagtcaaagtggcgatagg
cctgaaataagaaagagtcaaagagagatagtcccagtgacttgtagtatgataaacaac
atgtcacctggagaagataatttgagaattggcacatatgaagtttcgcaggtttgtatt
gtggctgttattagagacgtatcttacggtgacatctatactgacatcacaattgatgat
atgacttcttctcctattactgcgagacagtgggtgaaggtacattcaatttacgtagtg
aaggtagttacaatacagtatttagctgtaatttgcattgttaaggaaaacaaaaataca
gaagaaatgcagaaaaaatgcaattcacttgttaaagtttttggtaatattaccactttt
caaaaaaagaaaattttgacggtatttgggatgatgacggtggcagatttgaatgacttg
acagtgcacttgcttgaagtgttgcgagcaaagctttcttttgaaaaggattgtttaaac
actgatagaaaagagtcgaatcgaccaaaagatgctaccccttttatgtcttacggtact
tctgaaatgcaagcggacaacaaaatgacttatgacaatggattgtctggtcttagagcg
gagatttatcgattcttgagcaacaatgatacaatcgaaggatgcagtgtgaatgatata
aagtcacattttgcacacgtcactatgagcaagttgagagatgaaattgaatttttgtgc
tgcgaaggccacatttattctaccattgatgaagatcattttaaagcatctgacgaatga

DBGET integrated database retrieval system