KEGG   Trichinella spiralis: Tsp_05207Help
Entry
Tsp_05207         CDS       T01609                                 

Definition
(RefSeq) abhydrolase domain-containing protein 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Tsp_05207
Peptidases [BR:tsp01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Tsp_05207
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Tsp_05207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 328 aa AA seqDB search
MGTICQTTLLAGSFLVFLYGIVPLLLYLFPNIELSLIFMSAVNWPFTNYSDPRAYGVKYD
SRNFYLTSSDGIKLGVWHMLPKSLHESSVLNEKEFGTVFDDERYPVVLYFHGNTWSRCAS
HRIQLYNIFTELNYHVVAFDYRGFADSTGSASEEGMNKDAHTVYQWIRTHSNRTSVLFWG
HSLGTAVATRFAADLCLSGNCPLGLVLEAPFNNMFDAVKNHPFTSMYRWHPWFAEIFTYP
LLKYNVHFKSDEHIKNVYCPILILHAEDDNIIPSQLARQLHEAALSADRDSTFKEFSRTK
KYGHKFIVREPELPTITKNFVKKCTSGI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgatttgtcaaacaactctactagcaggatcctttttagtttttctctatggc
attgtaccactacttttatatctgtttccaaatattgaattatcattgatctttatgtca
gctgtgaattggccttttactaattatagtgatcctcgagcttatggagtgaaatatgat
agcagaaatttttatctgactagttctgatggtattaaattgggcgtatggcacatgttg
ccaaaatcacttcatgaatcgtctgttctcaatgaaaaagaatttggtactgtttttgat
gatgaacgttatccagttgttttatattttcatggaaacacatggagtcgctgtgctagt
catcgaattcaattatataacatttttacagagttgaattatcatgttgtggcatttgat
tacagaggctttgctgattctactggaagtgcttcggaagaaggtatgaacaaagatgca
catacggtttatcaatggataagaactcattcaaatcgaacttcagtattattttggggt
cattctctaggtactgctgttgctactcggtttgctgccgatctttgcttatccggcaat
tgtccacttggattagttttagaagcaccatttaataatatgtttgatgctgtaaaaaat
catccatttacatctatgtatcgctggcatccatggtttgcggaaatattcacatatcca
cttttgaaatacaatgtccattttaaatcggatgagcatataaaaaatgtttattgtcca
atattgattttacacgcagaagatgataacattattccttctcaactagcaaggcaactt
catgaagcggctctttctgctgatcgagattccacatttaaagaatttagtcgtacgaag
aaatatggtcataagtttattgttcgtgaacccgaactgccaacgattactaaaaatttt
gtcaaaaagtgtacatctgggatatga

DBGET integrated database retrieval system