KEGG   Trichinella spiralis: Tsp_05307Help
Entry
Tsp_05307         CDS       T01609                                 

Definition
hypothetical protein
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
tsp  Trichinella spiralis
Brite
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tsp_05307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 405 aa AA seqDB search
MPTWEQVALTLSNEPITVGKLDCTKHTSVTSELKINGYPTVRIPEVRPLSDRYELVRVCE
KLKKTAFFLLAGEKNVSNPLIVREFEEYYAVAKKLFSKTYFYQILPRHLPSTFPCDETVC
IFVVKDGTQFLYNPTTDQNSLEKWIQSSRWPFMQLAKYETLNEMGECCNDKLLVVAVLDL
VEKRKLKSPVKQLDDLIRMTWQQYSEQLKGKFQFVWLDGNEIANSILLRTVPVPCLFVFN
ASSYSYYLPDQDALQMTEEILLQFLQNVVNGFVAMRGGKGRVQHVRRIFYETTTAIYVNF
FSSTNRLLASVYCYANFIVLDFRRCSPISHCWRAVCSACRWEFSALYVTQSVQRTFPSIA
TKSTRTATIPVNLFKFIIFFLYLNFFHLVKLSTTATDSDDHEKEE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctgggaacaagtggcgttgacgctttccaacgagccgatcacggttggaaag
ttggactgcaccaaacacacatccgtgacgtcagaattgaaaatcaacggctatccaaca
gttcgaatacccgaagtgagacctctgtccgataggtatgaacttgtgcgagtttgtgaa
aagttgaaaaagacggcattttttctcctggcaggggagaaaaatgtttccaatcccttg
attgtacgcgaatttgaagagtattatgcggttgcgaagaagttgttttccaaaacgtat
ttttatcaaattttaccgagacatttaccgtcaacttttccatgcgacgaaacggtgtgc
atttttgtcgtcaaagatggtacacaatttctctacaatccaacgactgatcaaaattct
ttggaaaaatggatacaaagttcgcgatggccattcatgcaattggccaaatatgaaacg
ctgaacgaaatgggcgaatgttgcaatgataagctgcttgttgtggccgttcttgatctg
gtcgaaaagagaaaattgaaaagtcccgtcaaacaattggacgatttgattcggatgaca
tggcaacagtatagtgaacagttgaagggcaaatttcaatttgtctggcttgacggcaac
gaaattgccaacagcatattgctgagaaccgtgccggttccgtgtttgttcgttttcaac
gcctcttcatattcctattatcttcccgaccaggatgctctgcaaatgaccgaagaaata
ttgttgcaatttttgcaaaacgtcgtcaacggtttcgtcgcgatgcgcggaggcaaggga
cgtgtgcaacatgtgagacgaattttttacgaaacaacaaccgcaatttatgtaaatttt
ttctcttcaactaaccgcttgctggcgagcgtatattgttatgcaaatttcattgtactc
gatttcagacgatgttcgccaatcagccattgttggcgtgctgtttgttcggcttgccgt
tgggaattttcagcgttatatgttacacaatctgttcaacggacgtttccgtcgatagcg
acgaaatctacgcggacagctacgattccggtaaatttattcaaatttattatttttttt
ctttatttaaatttttttcacctcgtcaaattgtcaacaacagcaacagacagtgatgat
cacgaaaaagaagaatga

DBGET integrated database retrieval system