KEGG   Trichinella spiralis: Tsp_05343Help
Entry
Tsp_05343         CDS       T01609                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp00010  Glycolysis / Gluconeogenesis
tsp00051  Fructose and mannose metabolism
tsp00562  Inositol phosphate metabolism
tsp01100  Metabolic pathways
tsp01200  Carbon metabolism
tsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsp_05343
   00051 Fructose and mannose metabolism
    Tsp_05343
   00562 Inositol phosphate metabolism
    Tsp_05343
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tsp_05343
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tsp_05343
  Exosomal proteins of bladder cancer cells
   Tsp_05343
  Exosomal proteins of melanoma cells
   Tsp_05343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 10913135
NCBI-ProteinID: XP_003371670
UniProt: E5SS61
Position
Unknown
AA seq 278 aa AA seqDB search
MTKCNIHYPYDSCFATKVSVGVVLVLYHAMSSRKFFVGGNWKMNGDSKSIEEYIKLLNDN
TLPGNVEIVIAPPFVYLERIRKQLKPAVGLSAQNCYKVEKGAFTGEVSASMLRDIGCDWV
ILGHSERRHILHESDELVAEKVSMALNSGLGVIFCVGEKLDEREGGKTKDVCFRQLASLL
KYKLDWNNIVIAYEPVWAIGTGKTASPEQAQEVHVWIRDWLKQNVSADAAAKCRIIYGGS
VTGDNCRALGKQSDIDGFLVGGASLKPEFLKIIEARSN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatgcaatattcattatccatatgacagttgttttgcaacgaaagtcagtgtt
ggtgttgtgttggtcttatatcacgcgatgtcttcgagaaagttttttgttggagggaac
tggaaaatgaatggagactctaagagcattgaagagtacataaaacttttaaacgacaac
acattgcctggcaatgtagaaatcgttattgctccgccatttgtgtatttggaaagaatt
aggaaacagctaaagcctgctgttggtttgtcggcgcaaaactgttataaagttgaaaaa
ggagcatttacaggcgaagttagcgcttctatgctgcgagatattggatgcgattgggta
attcttggtcattctgaacgtcgtcatatacttcatgaatcggatgagttagtagctgaa
aaggttagtatggcattaaattctggtttgggagtgatcttctgcgttggcgaaaagctt
gatgagcgcgaagggggaaaaacaaaggacgtttgctttcgtcagttggcatcacttttg
aagtacaagttagattggaacaatattgtcattgcatatgaaccagtttgggcgatcgga
actgggaaaactgcttcgccggaacaggctcaggaagtgcacgtgtggattcgcgactgg
ttgaagcaaaatgttagcgccgacgcagctgctaaatgccggattatttacggaggttct
gtcactggcgataactgtcgtgcattgggaaaacaatcggacattgacggctttttggtt
ggtggtgcatcgttgaagccagaatttttgaaaattatcgaagcgcgttctaactaa

DBGET integrated database retrieval system