KEGG   Trichinella spiralis: Tsp_05343Help
Entry
Tsp_05343         CDS       T01609                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsp  Trichinella spiralis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tsp_05343
   01230 Biosynthesis of amino acids
    Tsp_05343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsp_05343
   00051 Fructose and mannose metabolism
    Tsp_05343
   00562 Inositol phosphate metabolism
    Tsp_05343
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tsp_05343
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tsp_05343
  Exosomal proteins of bladder cancer cells
   Tsp_05343
  Exosomal proteins of melanoma cells
   Tsp_05343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 278 aa AA seqDB search
MTKCNIHYPYDSCFATKVSVGVVLVLYHAMSSRKFFVGGNWKMNGDSKSIEEYIKLLNDN
TLPGNVEIVIAPPFVYLERIRKQLKPAVGLSAQNCYKVEKGAFTGEVSASMLRDIGCDWV
ILGHSERRHILHESDELVAEKVSMALNSGLGVIFCVGEKLDEREGGKTKDVCFRQLASLL
KYKLDWNNIVIAYEPVWAIGTGKTASPEQAQEVHVWIRDWLKQNVSADAAAKCRIIYGGS
VTGDNCRALGKQSDIDGFLVGGASLKPEFLKIIEARSN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatgcaatattcattatccatatgacagttgttttgcaacgaaagtcagtgtt
ggtgttgtgttggtcttatatcacgcgatgtcttcgagaaagttttttgttggagggaac
tggaaaatgaatggagactctaagagcattgaagagtacataaaacttttaaacgacaac
acattgcctggcaatgtagaaatcgttattgctccgccatttgtgtatttggaaagaatt
aggaaacagctaaagcctgctgttggtttgtcggcgcaaaactgttataaagttgaaaaa
ggagcatttacaggcgaagttagcgcttctatgctgcgagatattggatgcgattgggta
attcttggtcattctgaacgtcgtcatatacttcatgaatcggatgagttagtagctgaa
aaggttagtatggcattaaattctggtttgggagtgatcttctgcgttggcgaaaagctt
gatgagcgcgaagggggaaaaacaaaggacgtttgctttcgtcagttggcatcacttttg
aagtacaagttagattggaacaatattgtcattgcatatgaaccagtttgggcgatcgga
actgggaaaactgcttcgccggaacaggctcaggaagtgcacgtgtggattcgcgactgg
ttgaagcaaaatgttagcgccgacgcagctgctaaatgccggattatttacggaggttct
gtcactggcgataactgtcgtgcattgggaaaacaatcggacattgacggctttttggtt
ggtggtgcatcgttgaagccagaatttttgaaaattatcgaagcgcgttctaactaa

DBGET integrated database retrieval system