KEGG   Trichinella spiralis: Tsp_05639Help
Entry
Tsp_05639         CDS       T01609                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tsp  Trichinella spiralis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tsp_05639
   01230 Biosynthesis of amino acids
    Tsp_05639
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsp_05639
   00030 Pentose phosphate pathway
    Tsp_05639
   00051 Fructose and mannose metabolism
    Tsp_05639
   00052 Galactose metabolism
    Tsp_05639
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tsp_05639
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tsp_05639
Protein phosphatases and associated proteins [BR:tsp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tsp_05639
Messenger RNA biogenesis [BR:tsp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tsp_05639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 885 aa AA seqDB search
MSLSKSDRTVELSSFLKSSPSVPLVERLLDECSIEFPFKRTNSAICNLTRDGEHVRPHLH
KGRLNLEPPFCAMADEADVVGESRDSVPVLPPQTVKPRFVSRLDSIVSFAGREGDLVLPR
SQIGRCLAVFTSGGDSQGMNAALRAVCRMGLYLGCQVYFIHEGYQGMVDGDRYIKEATWN
SVSDIIQKSGTIIGSARSKDFRTRQGRLKAAENLLKRNITNLVCIGGDGSLTGANTFRQE
WPELLNELVESGRISAEKAQQFPNINIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAVDA
VQSTAQSHQRSFVIEVMGRHCGYLALVAALASEADWAFIPEWPPPVDWRDILCTRMQQAR
EQGQRVNIIICAEGAVDRDGNPITSNMIRDLIVDRLHYDTRVTVLGHVQRGGNPSAFDRL
LGSRMGAEAVLALMDTSPDAESCVIALDGNSIVRVPLMQCVERTQLVQKAMEEKNWDLAV
RLRGRSFQRNLETYKLLAKLRPPTEKGNLSGGHIFTLAVMNVGAPACGMNAAVRSFVRNA
LCHNCKVLAVKDSFEGLMKGNVQEMNWCDVSNWSMFGGSFLGTQKSLPTKNIEKVVEQLR
NLKIDGLFLIGGFEAFHSCLIMAENRDKYKEFCIPMMVLPCTISNNVPGTSFSVGSDTAL
NEICNLIDKVKQSAIGTKRRVFIVETMGGYCGYLATLSALASGADNAYIFEEPFTVDDIK
EDVRVIAQKMVKGVQRYIIMRSENANPNYTTQFIMQLFSEEGKGEFSTRINILGHAQQGG
SATPFDRNLATRMAAHAVEFLVGKCREFFQPSDGRVFTNTPDSAVLLGIQARRSQATPIQ
EIKKKSDFVHRLPTEQWWLKLRPLLRILAKHDSIYEVSAVKMDLK
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagtctctcgaaaagcgaccgtactgtagaattgtcttcgtttctcaaatcaagtccg
tcggttccgcttgtggaacgactgctggacgaatgttcaattgagtttcccttcaaacgt
accaacagtgcgatatgcaatctgactcgcgacggcgagcacgtgcgtccgcatttgcac
aaggggcgtcttaatttggaaccgcctttttgcgctatggctgacgaggcggacgtggtc
ggcgaaagccgagattctgtgcctgtgcttccgcctcagacggtaaagccgagattcgta
tctcgactcgactcgatcgtcagttttgccggtcgagaaggcgatttagtactgcccaga
agtcaaattggacgctgtttggctgtttttacgagcggtggtgatagtcaaggaatgaac
gcagcgttgagagcagtgtgccgtatgggattgtatcttggttgccaagtttatttcatc
cacgaaggttatcagggtatggtcgacggcgacagatatatcaaagaagcgacttggaac
agcgttagtgatataattcaaaaaagtggaactattatcggcagtgcacgttcgaaagat
tttcgaacaagacagggtcgtctgaaggcggcggaaaatttattgaaacgcaacatcaca
aatttggtttgcatcggcggcgatggcagtttgacaggtgcgaatacatttcgccaagaa
tggccggaattgttgaacgaattggtcgaaagtggtcgaattagtgccgaaaaagcccaa
caatttcccaacatcaacatcgtcggattggtcggttcgattgacaacgacttttgcgga
accgacatgaccatcggtaccgataccgctttgcaccgaatcatcgaagcggtcgatgct
gtccaatccactgcccaaagtcaccagcgatcttttgtcatcgaagtcatgggacgacat
tgtggctatttggctttggtggccgcgttggcttccgaagcggattgggctttcattccc
gaatggccaccgccggtcgattggcgcgacattctctgcacccgcatgcaacaagctcgg
gaacaaggccaacgagtgaatattataatttgtgccgagggtgcggtcgaccgtgacggc
aatccaattacaagcaacatgattcgagatttgatcgtcgatcgtctccactacgatacc
agagtgaccgttttgggtcacgtccaacgtggtggtaatccgtcggcgttcgatcgtctg
ctcggcagtcgcatgggcgccgaagcggttttggctttgatggacacgtcgccggatgcg
gaatcttgcgttatcgcattggacggcaattcgatcgtccgcgtaccgttgatgcagtgt
gtcgaacgtacacaacttgtacagaaggcgatggaagagaaaaattgggatttggcggtc
cgtttgcgaggtcgaagtttccaaaggaacttggaaacgtacaaattgttggccaaattg
cgtccacctacggaaaaaggcaacctgagcggtgggcatattttcacgttggccgtgatg
aacgtcggcgctcccgcttgtggcatgaacgcggccgtgagatcctttgtccgcaatgct
ctttgtcacaactgcaaagtgttggcggtgaaagattcgttcgaaggtctgatgaaaggc
aacgtccaagagatgaactggtgcgacgtgagcaattggtcgatgtttggtggttcattt
ttgggaacccaaaaatcgctgccgacgaaaaatatcgaaaaagtggtcgaacagttgcgc
aatttgaaaattgacggtctctttttgatcggcggtttcgaagcttttcattcgtgcttg
atcatggccgaaaatcgtgacaaatacaaagaattttgcatcccaatgatggttttacca
tgtacgatcagcaacaacgttcccggaaccagcttttccgttggttccgacacggctttg
aatgaaatttgcaatttgatcgacaaagtgaaacagtcggccattggaaccaaacgacgc
gttttcattgtcgaaacgatgggcggctattgtggctatttggccacgttgtccgcactg
gcatccggagccgacaatgcgtacattttcgaagaaccgttcactgtcgacgacatcaaa
gaagacgtacgcgtgattgcgcaaaaaatggtcaaaggggtccagcggtatattatcatg
cgcagcgaaaatgccaatccaaattatacaacccagttcatcatgcaactgttcagcgaa
gaaggcaaaggcgaattcagtactcgtataaatattttgggccacgcccaacaaggcggt
agtgctacaccgtttgacagaaatttggctactcgaatggccgctcatgcggtggaattt
ttggttggcaagtgtcgagaatttttccaacccagcgacggccgtgtatttaccaacaca
cccgattcggccgtactgctcggcattcaagcacgtcgatcccaagcgacgccgattcaa
gagatcaaaaaaaagagcgattttgttcatcgtttgccaaccgaacagtggtggttgaag
ctacgaccgttgcttcgcattttagccaaacacgacagcatatacgaagtgtcggccgtg
aaaatggacttgaaatga

DBGET integrated database retrieval system