KEGG   Trichinella spiralis: Tsp_05639Help
Entry
Tsp_05639         CDS       T01609                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tsp  Trichinella spiralis
Pathway
tsp00010  Glycolysis / Gluconeogenesis
tsp00030  Pentose phosphate pathway
tsp00051  Fructose and mannose metabolism
tsp00052  Galactose metabolism
tsp01100  Metabolic pathways
tsp01200  Carbon metabolism
tsp01230  Biosynthesis of amino acids
tsp03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsp_05639
   00030 Pentose phosphate pathway
    Tsp_05639
   00051 Fructose and mannose metabolism
    Tsp_05639
   00052 Galactose metabolism
    Tsp_05639
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tsp_05639
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tsp_05639
Protein phosphatases and associated proteins [BR:tsp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tsp_05639
Messenger RNA biogenesis [BR:tsp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tsp_05639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 10913459
NCBI-ProteinID: XP_003371993
UniProt: E5ST18
Position
Unknown
AA seq 885 aa AA seqDB search
MSLSKSDRTVELSSFLKSSPSVPLVERLLDECSIEFPFKRTNSAICNLTRDGEHVRPHLH
KGRLNLEPPFCAMADEADVVGESRDSVPVLPPQTVKPRFVSRLDSIVSFAGREGDLVLPR
SQIGRCLAVFTSGGDSQGMNAALRAVCRMGLYLGCQVYFIHEGYQGMVDGDRYIKEATWN
SVSDIIQKSGTIIGSARSKDFRTRQGRLKAAENLLKRNITNLVCIGGDGSLTGANTFRQE
WPELLNELVESGRISAEKAQQFPNINIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAVDA
VQSTAQSHQRSFVIEVMGRHCGYLALVAALASEADWAFIPEWPPPVDWRDILCTRMQQAR
EQGQRVNIIICAEGAVDRDGNPITSNMIRDLIVDRLHYDTRVTVLGHVQRGGNPSAFDRL
LGSRMGAEAVLALMDTSPDAESCVIALDGNSIVRVPLMQCVERTQLVQKAMEEKNWDLAV
RLRGRSFQRNLETYKLLAKLRPPTEKGNLSGGHIFTLAVMNVGAPACGMNAAVRSFVRNA
LCHNCKVLAVKDSFEGLMKGNVQEMNWCDVSNWSMFGGSFLGTQKSLPTKNIEKVVEQLR
NLKIDGLFLIGGFEAFHSCLIMAENRDKYKEFCIPMMVLPCTISNNVPGTSFSVGSDTAL
NEICNLIDKVKQSAIGTKRRVFIVETMGGYCGYLATLSALASGADNAYIFEEPFTVDDIK
EDVRVIAQKMVKGVQRYIIMRSENANPNYTTQFIMQLFSEEGKGEFSTRINILGHAQQGG
SATPFDRNLATRMAAHAVEFLVGKCREFFQPSDGRVFTNTPDSAVLLGIQARRSQATPIQ
EIKKKSDFVHRLPTEQWWLKLRPLLRILAKHDSIYEVSAVKMDLK
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagtctctcgaaaagcgaccgtactgtagaattgtcttcgtttctcaaatcaagtccg
tcggttccgcttgtggaacgactgctggacgaatgttcaattgagtttcccttcaaacgt
accaacagtgcgatatgcaatctgactcgcgacggcgagcacgtgcgtccgcatttgcac
aaggggcgtcttaatttggaaccgcctttttgcgctatggctgacgaggcggacgtggtc
ggcgaaagccgagattctgtgcctgtgcttccgcctcagacggtaaagccgagattcgta
tctcgactcgactcgatcgtcagttttgccggtcgagaaggcgatttagtactgcccaga
agtcaaattggacgctgtttggctgtttttacgagcggtggtgatagtcaaggaatgaac
gcagcgttgagagcagtgtgccgtatgggattgtatcttggttgccaagtttatttcatc
cacgaaggttatcagggtatggtcgacggcgacagatatatcaaagaagcgacttggaac
agcgttagtgatataattcaaaaaagtggaactattatcggcagtgcacgttcgaaagat
tttcgaacaagacagggtcgtctgaaggcggcggaaaatttattgaaacgcaacatcaca
aatttggtttgcatcggcggcgatggcagtttgacaggtgcgaatacatttcgccaagaa
tggccggaattgttgaacgaattggtcgaaagtggtcgaattagtgccgaaaaagcccaa
caatttcccaacatcaacatcgtcggattggtcggttcgattgacaacgacttttgcgga
accgacatgaccatcggtaccgataccgctttgcaccgaatcatcgaagcggtcgatgct
gtccaatccactgcccaaagtcaccagcgatcttttgtcatcgaagtcatgggacgacat
tgtggctatttggctttggtggccgcgttggcttccgaagcggattgggctttcattccc
gaatggccaccgccggtcgattggcgcgacattctctgcacccgcatgcaacaagctcgg
gaacaaggccaacgagtgaatattataatttgtgccgagggtgcggtcgaccgtgacggc
aatccaattacaagcaacatgattcgagatttgatcgtcgatcgtctccactacgatacc
agagtgaccgttttgggtcacgtccaacgtggtggtaatccgtcggcgttcgatcgtctg
ctcggcagtcgcatgggcgccgaagcggttttggctttgatggacacgtcgccggatgcg
gaatcttgcgttatcgcattggacggcaattcgatcgtccgcgtaccgttgatgcagtgt
gtcgaacgtacacaacttgtacagaaggcgatggaagagaaaaattgggatttggcggtc
cgtttgcgaggtcgaagtttccaaaggaacttggaaacgtacaaattgttggccaaattg
cgtccacctacggaaaaaggcaacctgagcggtgggcatattttcacgttggccgtgatg
aacgtcggcgctcccgcttgtggcatgaacgcggccgtgagatcctttgtccgcaatgct
ctttgtcacaactgcaaagtgttggcggtgaaagattcgttcgaaggtctgatgaaaggc
aacgtccaagagatgaactggtgcgacgtgagcaattggtcgatgtttggtggttcattt
ttgggaacccaaaaatcgctgccgacgaaaaatatcgaaaaagtggtcgaacagttgcgc
aatttgaaaattgacggtctctttttgatcggcggtttcgaagcttttcattcgtgcttg
atcatggccgaaaatcgtgacaaatacaaagaattttgcatcccaatgatggttttacca
tgtacgatcagcaacaacgttcccggaaccagcttttccgttggttccgacacggctttg
aatgaaatttgcaatttgatcgacaaagtgaaacagtcggccattggaaccaaacgacgc
gttttcattgtcgaaacgatgggcggctattgtggctatttggccacgttgtccgcactg
gcatccggagccgacaatgcgtacattttcgaagaaccgttcactgtcgacgacatcaaa
gaagacgtacgcgtgattgcgcaaaaaatggtcaaaggggtccagcggtatattatcatg
cgcagcgaaaatgccaatccaaattatacaacccagttcatcatgcaactgttcagcgaa
gaaggcaaaggcgaattcagtactcgtataaatattttgggccacgcccaacaaggcggt
agtgctacaccgtttgacagaaatttggctactcgaatggccgctcatgcggtggaattt
ttggttggcaagtgtcgagaatttttccaacccagcgacggccgtgtatttaccaacaca
cccgattcggccgtactgctcggcattcaagcacgtcgatcccaagcgacgccgattcaa
gagatcaaaaaaaagagcgattttgttcatcgtttgccaaccgaacagtggtggttgaag
ctacgaccgttgcttcgcattttagccaaacacgacagcatatacgaagtgtcggccgtg
aaaatggacttgaaatga

DBGET integrated database retrieval system