KEGG   Trichinella spiralis: Tsp_05770Help
Entry
Tsp_05770         CDS       T01609                                 

Definition
stress-activated protein kinase JNK
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tsp04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tsp04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tsp04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tsp04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tsp04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 447 aa AA seqDB search
MANRWIGWPREGKEQLQAQPLASSTFASVLSTSSKKRNSGTNTKQQSSQTACSGHWSPRL
APMSNVNGSSSSASSASSAARLNHNQDQFYQIEVSDTRMLILKRAANDIVSGRNVAIKKL
SRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQKMLEEFADLYIVMELMDANLCQ
VIQMELDHERMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAG
NSFMMTPYVVTRYYRAPEVILGMGYKENEEFTNSSQFFFVPVDIWSVGCIFGEMIRGNVL
FPGTDHIDQWSKITEQLGTPSADFMRRLQPTVRHFVENRSRHSGFAFDRLFPDRMFPKNS
SDLRLSAQQARDLLSKMLVIDPEKRISVDDALQHPYVNVWFDESEPPPAKYDHAVDEQEH
SVDQWKELIFREIMDYEESHDVYGTTF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacagatggatcggatggcccagggaaggcaaggagcagttgcaagcgcagcct
cttgcttcttcaacgtttgcttcggttttgtcaacgtcgtcgaaaaagcgtaacagcggc
acaaacacaaagcagcagtcaagtcagacggcttgtagtggtcattggtcacctcgattg
gcacccatgtcgaacgtcaacggttcatcctcatctgcatcgtcggcgtcgtcggccgca
cggctcaatcacaaccaggaccaattttaccaaattgaagtcagcgacactagaatgctg
attttgaaacgcgctgccaacgacattgttagtggacgtaatgtcgccatcaagaaactc
agtcggccgtttcaaaacgttacccatgctaagcgagcctatcgtgagttcaaactgatg
aagttggtcaatcataagaatattattggtctgttgaatgcattcactccacaaaaaatg
ctcgaagaatttgccgatctgtacatagtgatggaactgatggatgctaatctctgccaa
gtgattcaaatggaacttgatcatgaaaggatgtcctatttgctttatcaaatgctttgc
ggcattaggcatctgcacgctgccggtataattcaccgagatcttaaacctagcaatatt
gtagtgaagagcgattgctctttgaaaattctcgactttggtctagccagatcggccggt
aacagtttcatgatgactccgtacgtggtcactcgttattatcgtgctcctgaagtaatt
ctcggcatgggatacaaagagaatgaagaattcactaattcaagccagttttttttcgtt
ccagttgacatctggtcagtgggttgtatttttggagaaatgatccggggaaatgtgctt
tttcctggcactgatcatattgaccagtggagcaagattaccgaacagttgggcacacca
tctgcggactttatgcgacgactgcagccaacagttcgtcattttgtagaaaatcgtagt
cgacatagtggttttgcttttgatcgactttttcctgatcgcatgtttccaaaaaatagt
tctgatttacgtttatccgcgcagcaagctagagatttattgtcgaaaatgttggtcatc
gacccggagaaacgcatctctgttgatgacgcattacagcatccctatgtgaacgtgtgg
ttcgatgaaagtgaaccaccgccggcaaaatatgatcatgctgttgatgagcaagagcat
tcggtggatcagtggaaagaactgattttccgggaaattatggattacgaagagtctcac
gacgtatacggtacaacattttga

DBGET integrated database retrieval system