KEGG   Trichinella spiralis: Tsp_05770Help
Entry
Tsp_05770         CDS       T01609                                 

Definition
stress-activated protein kinase JNK
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tsp_05770
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Tsp_05770
   04012 ErbB signaling pathway
    Tsp_05770
   04310 Wnt signaling pathway
    Tsp_05770
   04068 FoxO signaling pathway
    Tsp_05770
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tsp_05770
Protein kinases [BR:tsp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Tsp_05770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 447 aa AA seqDB search
MANRWIGWPREGKEQLQAQPLASSTFASVLSTSSKKRNSGTNTKQQSSQTACSGHWSPRL
APMSNVNGSSSSASSASSAARLNHNQDQFYQIEVSDTRMLILKRAANDIVSGRNVAIKKL
SRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQKMLEEFADLYIVMELMDANLCQ
VIQMELDHERMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAG
NSFMMTPYVVTRYYRAPEVILGMGYKENEEFTNSSQFFFVPVDIWSVGCIFGEMIRGNVL
FPGTDHIDQWSKITEQLGTPSADFMRRLQPTVRHFVENRSRHSGFAFDRLFPDRMFPKNS
SDLRLSAQQARDLLSKMLVIDPEKRISVDDALQHPYVNVWFDESEPPPAKYDHAVDEQEH
SVDQWKELIFREIMDYEESHDVYGTTF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacagatggatcggatggcccagggaaggcaaggagcagttgcaagcgcagcct
cttgcttcttcaacgtttgcttcggttttgtcaacgtcgtcgaaaaagcgtaacagcggc
acaaacacaaagcagcagtcaagtcagacggcttgtagtggtcattggtcacctcgattg
gcacccatgtcgaacgtcaacggttcatcctcatctgcatcgtcggcgtcgtcggccgca
cggctcaatcacaaccaggaccaattttaccaaattgaagtcagcgacactagaatgctg
attttgaaacgcgctgccaacgacattgttagtggacgtaatgtcgccatcaagaaactc
agtcggccgtttcaaaacgttacccatgctaagcgagcctatcgtgagttcaaactgatg
aagttggtcaatcataagaatattattggtctgttgaatgcattcactccacaaaaaatg
ctcgaagaatttgccgatctgtacatagtgatggaactgatggatgctaatctctgccaa
gtgattcaaatggaacttgatcatgaaaggatgtcctatttgctttatcaaatgctttgc
ggcattaggcatctgcacgctgccggtataattcaccgagatcttaaacctagcaatatt
gtagtgaagagcgattgctctttgaaaattctcgactttggtctagccagatcggccggt
aacagtttcatgatgactccgtacgtggtcactcgttattatcgtgctcctgaagtaatt
ctcggcatgggatacaaagagaatgaagaattcactaattcaagccagttttttttcgtt
ccagttgacatctggtcagtgggttgtatttttggagaaatgatccggggaaatgtgctt
tttcctggcactgatcatattgaccagtggagcaagattaccgaacagttgggcacacca
tctgcggactttatgcgacgactgcagccaacagttcgtcattttgtagaaaatcgtagt
cgacatagtggttttgcttttgatcgactttttcctgatcgcatgtttccaaaaaatagt
tctgatttacgtttatccgcgcagcaagctagagatttattgtcgaaaatgttggtcatc
gacccggagaaacgcatctctgttgatgacgcattacagcatccctatgtgaacgtgtgg
ttcgatgaaagtgaaccaccgccggcaaaatatgatcatgctgttgatgagcaagagcat
tcggtggatcagtggaaagaactgattttccgggaaattatggattacgaagagtctcac
gacgtatacggtacaacattttga

DBGET integrated database retrieval system