KEGG   Trichinella spiralis: Tsp_05773Help
Entry
Tsp_05773         CDS       T01609                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 559 aa AA seqDB search
MDMNLHNREAESKVLMIYTGGTIGMRSENNGNRKFYSKPYVPVENYLLQAIRADSYLNDA
AYVNKYYSHVEDKPCALPHVQFENKRIVYWIIEYQPLLDSSDMSFEEWIKIANTISENYE
NYDGFVILHGTDTLCFTASALSFMFENLGKSIVLTGSQIPVCEVTIYFNSKLFRGNRTTK
YDNNSLDAFCSPNVPPLATMDIRVNVHWEAVFRSTEMKKMTVQVEMNPNIALLRIFPSIS
CDCIRAFFAPPMEGIVLQTYGGGNMPARRSDAFAVIKDGIKNGQIVVNCSQCLRGQVSPL
YRTGQLLYECGVISGSDMTTEAALTKLAYVLAKKDLTLEDKKALMGQNLRGELTVTKEQH
HHYQDHNLVIEFAKYLNISSSMELKKLRKLLYPTLLCQAACEGDLELLKTLKRNGAFSVG
LDHLHRSPLHCAAGRGHLEIVEFLLTSGVSVHAKDRNHSTPLMEAVRNGHMEIIDLLRKT
GAHLSLNPLQACSLGRDEVVEFLLKNNADPFAVDSNGYNCLDKALINQHKKCAKLVRYYM
ENKTISNSNKVCKEDTAET
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaatctccacaatcgagaagcggaaagtaaagttctgatgatctatactggc
ggcaccattggaatgcgatcagaaaacaatggcaatagaaaattctattccaaaccatac
gtgccagttgaaaactatcttttgcaagcgattcgggcggattcttacctgaatgatgct
gcctatgtaaataaatattattctcacgttgaagataagccgtgcgccttacctcatgtt
caattcgaaaataaacgcatcgtttattggatcatcgaatatcaaccgttactggattca
tcagacatgtcctttgaagaatggataaaaatagcaaatacaataagtgaaaattatgaa
aattatgacggtttcgtcattctgcacggcacagatacgctgtgcttcacggccagcgcg
ttgagcttcatgtttgaaaatttgggcaaatcaatcgtgcttaccggttctcaaattccc
gtgtgcgaagtaactatttatttcaactcgaaactatttcgtggcaatcgtacaacaaag
tacgacaacaattctctggatgctttctgcagtcccaacgttccaccactggctacgatg
gatattcgagtgaacgttcactgggaagcggtgtttcgttctacagaaatgaaaaaaatg
accgtacaagtggagatgaatcccaatatcgctttgttgcgtattttcccatccatctct
tgcgattgcatcagagccttctttgctccgccaatggaaggaatcgttttgcaaacatac
ggcggaggcaatatgccagctagacgaagtgatgcatttgctgtaataaaagacggtata
aaaaatggtcagattgtcgtcaactgttcccagtgcttaagaggccaagtttcaccactg
tacagaactggtcagttgctttatgagtgtggtgtcatctcgggctcggatatgactact
gaagcagcgctgacaaaactcgcctatgtacttgctaagaaagatcttaccttggaggat
aaaaaagcgctaatggggcagaacttacgaggagaacttaccgttactaaagagcaacat
catcattatcaagatcacaatttggtgattgaattcgccaaatatttaaacatttcgagt
agtatggagttgaagaagctgagaaagctgctctatccgaccctattatgccaagcagcc
tgcgaaggcgatctagaacttttaaaaactttgaaaagaaatggggctttttcggttggc
ttagatcatctgcatcgatcaccgttgcactgcgctgccggtaggggtcatttggaaatt
gtcgaatttctcctcacttccggtgtttctgttcacgcaaaagatcgtaatcatagcaca
ccgttgatggaagcggtgcgtaacggacatatggaaataattgatttattgcgaaaaaca
ggtgcccatctcagtttgaatcctctgcaagcatgcagcctgggtcgtgatgaggttgta
gaatttcttttaaaaaataatgccgatccgtttgcggtggattcgaatggttacaactgc
ttggataaggcgttaatcaaccaacacaaaaaatgcgcaaaattggttcgatattatatg
gaaaacaaaacaatcagtaatagcaataaagtgtgcaaagaagacactgcagaaacatag

DBGET integrated database retrieval system