KEGG   Trichinella spiralis: Tsp_05985Help
Entry
Tsp_05985         CDS       T01609                                 

Definition
putative bromodomain protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tsp  Trichinella spiralis
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:tsp04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 878 aa AA seqDB search
MAECSRQKASTSNGEKMTNLSALPRNVKIAKLGCYGKCQVRRCRCRGWKRHHCWQDSLPA
TEVHLSETCRLCGDPFRCHINHLKDKTDDEIDKLMEMALTMERLYAIKQRETNENRKMLY
HCIFMSLRHCISEGRSYQLECPLGNPPFESPNVMELLKLFQASNHASGSIEKDAKDATAV
DLFVAWIDSCVLLAPEQVLNPKTLEDLIQVEYAVHYGRWFLFCHVPARWECLKPQKPSVI
FGATFLLSVFDSLRSGLLKEISQYADRSFSMVNRVDSLFDHLHAFLLDTKCWSQPCLQRS
LISLPNSLSFHYYNDLNVKSERATLKEGPSECAINGDRLTVPSTSTINHTASQVGRKRRR
SSLANSNPEINSKVKMEKPIDVNNKETMDQYLQRVIADLEKCKKERRLEPVLGVELAREE
EATGVISVHVVNNNLELDQDGRKLLWLLQLQNVFALQLPRMPLEYIARIVFDYKHKNLIL
VKNEVVIGGISFRMFPAQDFSEIVFCAVVGSEQVKGYGTHMMNHLKDYHVQKGIYDFLTF
ADEFAVGYFKKQGFSESIHVPKSRYQGYIKEYEGAAFMACKLNPKVNYCFLGPLIKKQKE
VLHLLTDRISCSQPSADVIYQAPKFDSTVTLPLKLETIAGIVCVCVCAREIESVIESGFQ
MPTDYTCNLSSEELNSKLRAILNKVRNSFAAWPFLKPVNAEEVPDYYGYIKYPIDLRTMG
ERIRSGYYCHPKLFKADMMRMFSNCKHFNHETTEYYKAAVSLQKVFLNLWAKEKWESTKV
NAPQTNRTFGLLSTRAQISRRLTVHFVNNAVGACIEFPFENISTFSLVFVPVYLCKFFRL
TVEMSGTDMNTLPNDIDEFATSRFWETFYQKTGNNFEW
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtgcagtcgtcagaaagcttcgacaagcaacggtgagaagatgactaatttg
agtgcattgccgcggaacgtaaaaatcgcaaaattgggatgctatggtaaatgtcaggtg
cgacgatgtcgttgtcgaggttggaagcgtcatcattgttggcaagattcactaccggcc
actgaagtgcatctttctgaaacttgccgcttatgcggtgacccttttcgatgtcatatt
aatcatttgaaagacaaaacggacgacgagattgacaagctcatggaaatggccttgaca
atggaacgtctgtacgccattaaacaacgtgaaacgaatgaaaatagaaagatgttgtat
cactgtatattcatgtcgttgcggcattgcatttcagaaggccgttcttaccagcttgaa
tgccctttgggtaatccgccgtttgaatcaccaaacgtgatggaattgttgaaattgttt
caagcatcaaaccatgcttccggttcgattgaaaaggatgcgaaagatgcaactgcagtc
gatttgttcgttgcttggattgacagctgcgtattgttggcacctgagcaggtgttgaat
ccaaaaacgttggaggacttgattcaggtcgaatatgcagttcactacggtcgttggttt
ttgttctgccacgtgcctgctcgatgggaatgcttgaaaccgcaaaagccgtctgttatt
tttggagcaacttttctgttatcagttttcgatagtcttcgttcgggtctgcttaaggag
atcagccagtacgctgatcgatcgttttcgatggtcaatcgggtcgactcactgtttgac
cacttgcacgcttttcttttggacaccaagtgctggtcgcaaccgtgtctccaacgtagt
ctgatttcactgcccaactcgttgagctttcattattacaatgatttaaatgtcaaatct
gaacgtgcgacactgaaagaaggaccgtctgaatgtgcaattaacggtgatcgtttgact
gttccatctacatctacgataaatcatacagcatctcaggttggacgtaaacgacgtcga
tcgagtttagccaactcgaatccggaaattaatagcaaagtgaaaatggaaaagccgatc
gacgtgaacaacaaggagacgatggatcagtatctgcagcgtgtgattgcggatttggaa
aagtgcaagaaagagcgtcgtctggaaccagtgcttggagtggaattagcacgtgaagag
gaggcaactggtgtgatcagcgtgcacgtggtgaacaacaatttggagttggaccaagat
ggtcggaaattgctttggctgttgcaattgcagaatgtattcgctttgcagttgcctcgc
atgccattggaatacatagccagaattgtgttcgattacaagcacaaaaatttgatactt
gtaaaaaatgaagttgtgattggcggcatcagtttcagaatgtttccggcgcaggatttt
tctgagatcgtcttttgcgcagttgtcggaagtgagcaggtcaaaggttacggcacgcac
atgatgaatcatctcaaagattatcacgtgcagaaaggcatttatgattttttgacgttt
gccgacgaatttgctgttggctatttcaaaaagcagggattttccgaatctatccacgtg
cccaaaagtcgctatcagggttatatcaaagagtacgaaggcgcagcgttcatggcttgc
aagctgaatccaaaggttaactattgtttcttgggaccgttgatcaagaagcagaaagaa
gtgttgcacttgttaacagatcgtatctcttgcagccaaccgtccgcagatgtgatctac
caggcgcccaagttcgattcaacggtaacattaccgttgaaattggaaacgattgcaggt
attgtgtgtgtgtgtgtgtgcgcgcgcgaaattgaaagtgttattgaatcgggctttcaa
atgccgaccgattacacatgcaatttatcatccgaagagctcaattctaaattgagggcc
attttgaataaggtgcggaatagttttgccgcttggccatttctcaagccagttaacgcc
gaagaggttcccgattattatggctatataaaatatccgatcgatttgcgtacaatgggc
gagcgcattcgcagtggctactattgtcatccgaagttattcaaagcagacatgatgcgc
atgttcagcaactgcaagcatttcaatcatgaaacaaccgaatattacaaagcagccgtc
agtttgcagaaagtttttctcaatctttgggcgaaagaaaaatgggaatctaccaaagtg
aacgcgccacaaaccaaccgcacgttcggcttactttcaacgcgtgctcaaattagccga
cgtttaacggtgcattttgtgaataatgcagtgggcgcttgtatagaatttccgtttgaa
aatatttcgacattttcgcttgtttttgtccccgtttacctgtgtaagttttttcggctg
accgtcgaaatgtccggtacagatatgaataccttgccaaatgatatcgatgaatttgct
acatctcgtttttgggaaacattttatcaaaagactggtaacaactttgaatggtaa

DBGET integrated database retrieval system