KEGG   Trichinella spiralis: Tsp_05993Help
Entry
Tsp_05993         CDS       T01609                                 

Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tsp  Trichinella spiralis
Pathway
tsp00790  Folate biosynthesis
tsp01100  Metabolic pathways
Module
tsp_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tsp_05993
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tsp_05993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF IpaB_EvcA DUF3199
Motif
Other DBs
NCBI-GeneID: 10911224
NCBI-ProteinID: XP_003380282
UniProt: E5S527
Position
Unknown
AA seq 245 aa AA seqDB search
MFDNRSVRAVVRVGDSSRSSSSLTNAFGKRSMVVDSSNGLHSAADNDQKSTFLNVEQRSE
QEIQNDLAACYEQILKLVGEDCHRDGLQKTPQRAAQAMLFFTTGYSTDLTKVLNDAVFDE
DHDEMVIVRDIEMFSMCEHHLIPFIGRVSIGYLPNKKILGLSKLARIVEMYSRRLQVQER
LTKQIANAVVEAVQPSGVGVVIEASHMCMVMRGVQKYSAKTTTSCMLGTFQQDVKTREEF
LSLIR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaatcgttccgtcagagctgttgttcgagttggtgactcaagtcggagtagt
agttcattgactaatgcatttgggaagcgttctatggtcgtcgactcgagtaacggcctg
cattcagctgcagataatgatcagaagtcgacttttctcaacgtggagcaacgatctgaa
caggaaattcagaacgatctggcagcttgttatgagcaaattttgaaactcgtcggcgaa
gattgccaccgagatggtcttcagaaaacacctcaaagagctgcccaagcgatgcttttc
ttcacaaccggatacagtactgatttgacaaaagttttgaatgacgcagtttttgacgaa
gatcatgatgaaatggttattgttcgtgatattgaaatgttttccatgtgcgagcatcat
ttgataccgttcattggccgcgtttcgatcggctatttgcccaacaaaaaaattctcggt
ctgagcaaattggcgcgcattgttgaaatgtacagtcgtcgtttgcaagttcaggaacgt
ttgactaagcaaattgctaatgccgttgtcgaagcggtacaaccgtccggcgtgggagtg
gtcattgaagccagtcacatgtgcatggtgatgcgaggtgtgcaaaagtactccgccaaa
actacaaccagctgcatgttgggaacttttcagcaggatgtgaaaactcgagaagagttt
ctatctttgattcgttga

DBGET integrated database retrieval system