KEGG   Trichinella spiralis: Tsp_05993Help
Entry
Tsp_05993         CDS       T01609                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tsp  Trichinella spiralis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tsp_05993
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tsp_05993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
MFDNRSVRAVVRVGDSSRSSSSLTNAFGKRSMVVDSSNGLHSAADNDQKSTFLNVEQRSE
QEIQNDLAACYEQILKLVGEDCHRDGLQKTPQRAAQAMLFFTTGYSTDLTKVLNDAVFDE
DHDEMVIVRDIEMFSMCEHHLIPFIGRVSIGYLPNKKILGLSKLARIVEMYSRRLQVQER
LTKQIANAVVEAVQPSGVGVVIEASHMCMVMRGVQKYSAKTTTSCMLGTFQQDVKTREEF
LSLIR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaatcgttccgtcagagctgttgttcgagttggtgactcaagtcggagtagt
agttcattgactaatgcatttgggaagcgttctatggtcgtcgactcgagtaacggcctg
cattcagctgcagataatgatcagaagtcgacttttctcaacgtggagcaacgatctgaa
caggaaattcagaacgatctggcagcttgttatgagcaaattttgaaactcgtcggcgaa
gattgccaccgagatggtcttcagaaaacacctcaaagagctgcccaagcgatgcttttc
ttcacaaccggatacagtactgatttgacaaaagttttgaatgacgcagtttttgacgaa
gatcatgatgaaatggttattgttcgtgatattgaaatgttttccatgtgcgagcatcat
ttgataccgttcattggccgcgtttcgatcggctatttgcccaacaaaaaaattctcggt
ctgagcaaattggcgcgcattgttgaaatgtacagtcgtcgtttgcaagttcaggaacgt
ttgactaagcaaattgctaatgccgttgtcgaagcggtacaaccgtccggcgtgggagtg
gtcattgaagccagtcacatgtgcatggtgatgcgaggtgtgcaaaagtactccgccaaa
actacaaccagctgcatgttgggaacttttcagcaggatgtgaaaactcgagaagagttt
ctatctttgattcgttga

DBGET integrated database retrieval system