KEGG   Trichinella spiralis: Tsp_06016Help
Entry
Tsp_06016         CDS       T01609                                 

Definition
putative laminin
Orthology
K05635  
laminin, gamma 1
Organism
tsp  Trichinella spiralis
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Tsp_06016
Cell adhesion molecules and their ligands [BR:tsp04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Tsp_06016
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Tsp_06016
     Laminin-2 Extracellular matrix (ECM) components
      Tsp_06016
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Tsp_06016
   VLA-3
      Tsp_06016
     Laminin-10 Extracellular matrix (ECM) components
      Tsp_06016
     Laminin-11 Extracellular matrix (ECM) components
      Tsp_06016
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Tsp_06016
     Laminin-8 Extracellular matrix (ECM) components
      Tsp_06016
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Tsp_06016
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Tsp_06016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1253 aa AA seqDB search
MDTPIKTVVSTSAQEELDEYPQSSGRCVDENGVAQRCVPEFINAAFNRPVEVTNTCGLSR
PVEFCVQTGHSGMNKVCDVCDARVSSQAHPSFYLTDFNNPNNETWWQSETMAEGIQYPTT
VNMTINLVVKLEIIVLLHIYSNVNDCPVQGSLVIQCAWSDVAISKAFDITYVRLKFRSPR
PESFAIYKKSRADSDWSPWQYYSATCRSTYGVPEKAPILPNAEAVAQCSAEYSDISPLTG
GNVAFSTLEGRPSAHNFEESSVLQDWVTASEIRIVLTRLNTFGDEVFRDIKVLRSYYYAV
SDFAIGGRCKCNGHASRCVKSTGHGEEKLVCQCEHNTHGEDCDECLPFFNNRPWKAATAE
NANECQACDCNGLSNRCYFDEELYRMTGNGGHCINCAGNTRGAHCEACLENYWRAPGQQT
CLPCNCNEIGSVNMQCDDSGQCICKPGVGGQHCDRCLPGFYEFSALGCRDCGCLESGSLD
NQPSCRSDTGDCTCKRNVEGRQCERCRPGFFNLDLENEFGCTPCFCFGHSSVCDSALGYY
KSNITSTFDSCNFILFFAFLNYYYYPLFVLMYTARDGWKAERYDGRETELQYNLMDQAVS
VAEFDGPSYFIAPGKFRGNQRSAYNQILSFKLKVVQSNARASVRDIVLEGADGQVISVPV
FAQGNPVPASYEQIYRYRLHESADFGWTPSLSTTKFLGLLSNVTALKIRGTFAAGDVGGL
DDVILQSASMTPNGEELGQRAMWIESCQCPDNFVGQFCESCAPGFRREPKFGGPFSRCIK
CECHGHADLCEAESGRCICEHNTAGDNCERCARGFYGNALNGTVNDCIACPCPDSGPCLL
HTDDDIICLDCPNGYAGRRCEICSDGYFGEPSNGRNCTFCKCSGNIDPNSVGNCDRTTGE
CKKCIYNTHGFECEKCLPGFYGDALLEPKGDCKPCDCYSFGTYKPRTDYDFLECQQNDGQ
CQCLNHVTGRRCDQCENGYYNISSGEGCQPCNCDPLGSLNTSCDINTGQCVCKPGVIGRR
CDQCAMRHFGFGPKGCEACNCLVMGSVNLQCSITTGQCQCHPNIEGRQCDRCKENMYNLE
AGCLECPPCYKLIQKYAKQHREKLDELKDLLAEIIANPMVINDTNFEKKLAEVHEDVTKF
GVEVKERLAGGDSSLIKRVSKLRDDITKAEESLADVDHLLLETNFTISEAVNIMSSWDRI
KEKSYAELRHAQYFLNNDAVEAWNRARLASDRFGRPSEEMTNLAEEARQLAER
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggacactcctatcaaaactgttgtcagcacatccgcgcaagaagaacttgacgaatat
cctcaaagcagtggacgttgtgtggatgaaaatggcgttgctcagagatgtgtgcctgaa
ttcatcaacgccgccttcaaccgtcccgttgaagtgacaaacacttgcggattgtcgaga
cctgttgaattttgcgtgcagactggtcactctggaatgaacaaagtttgtgacgtttgc
gacgctcgagtgtcttcacaagcgcatccttcgttctacctaaccgacttcaacaatccc
aacaacgaaacttggtggcagtctgaaacaatggccgaaggcattcagtatccaacaact
gtcaacatgaccattaacctggttgtaaaattggaaataattgtgctgttgcatatttat
tccaatgtaaatgattgtccagttcaaggtagtctggtcattcagtgtgcatggtcagat
gtggcaatcagcaaagcatttgacattacgtacgttcggttgaagttccgcagtcccagg
ccggaaagttttgccatttacaaaaaaagccgtgccgatagtgactggagtccatggcag
tattacagtgccacatgtcgaagcacatatggtgtgccggagaaggcaccgattttaccc
aatgcagaagcagttgctcagtgtagtgctgaatattcggatatttcccctttgacagga
ggaaatgtggctttttcgacccttgaaggacgtccaagtgcgcacaattttgaagaatcg
tccgttttacaggattgggttacggctagtgaaatacgaatagtgttaacaagattgaac
acattcggcgacgaggttttccgagatattaaagttcttcgttcttattattacgcagtt
tctgattttgcgattggtggacgttgcaaatgcaatggtcatgcaagtaggtgtgtaaag
agcaccggtcacggtgaagagaaacttgtgtgccagtgtgagcacaatacacacggcgaa
gattgtgatgagtgtttgccatttttcaataatcgtccctggaaagctgctacagcagaa
aatgctaatgaatgtcaagcatgtgattgcaatggtttgtcaaatcgttgttattttgat
gaggagttgtatcgcatgacaggcaatggaggccattgtattaattgtgctggcaatact
cgtggagcacattgtgaagcatgtttggaaaattattggcgtgctcctggacagcaaaca
tgtttaccatgtaactgcaacgagattggttctgtcaacatgcagtgtgatgacagtgga
cagtgtatttgtaagccaggtgtaggaggacaacactgcgatcgttgtcttcctggattt
tatgaattttctgcgcttggttgcagagactgcggctgtttggaatctggaagcttagat
aatcaaccgtcttgtcgatcggatacaggtgattgcacatgtaagcgaaacgttgaaggt
cgtcagtgtgaacgatgccgaccgggattttttaatctggatctggaaaatgaatttggt
tgcactccatgcttctgcttcgggcattcatccgtttgcgactcagcacttggctattat
aaatcgaacattacttctacctttgattcgtgtaattttattttattttttgcatttttg
aattattattattatccattatttgttctaatgtacacagctcgtgacggctggaaagcg
gaacgttatgatggtagagaaactgaacttcagtataatttaatggatcaggcagtttct
gttgctgaatttgatggcccatcttatttcatagctccaggaaaattcagaggtaatcaa
cgatccgcttacaatcaaatattgtcattcaagctgaaagtggtccagtcgaatgctcgt
gcttcagtgagggatattgttttggaaggtgccgatggtcaagtgatttccgtgccagtg
tttgctcagggaaatcctgtaccggccagttatgaacaaatttatcgttatcgattgcat
gaaagtgcggattttggttggaccccgagtttgtcgacgaccaaatttctcggcttactt
tcaaatgttaccgcgttgaaaattcgtggaacttttgccgctggcgatgtcggtggtttg
gatgacgtcatacttcagtcggccagtatgactcccaatggagaagagcttggccagcga
gcaatgtggatcgagtcttgccagtgtccggataattttgttggtcaattctgcgagtcc
tgtgcaccgggctttagacgtgagccgaaattcggcggtccgttttcacggtgcatcaag
tgcgaatgccacggtcatgcagacctctgcgaagccgagtctggtcgttgtatatgtgag
cacaacaccgccggcgataattgcgaacgctgtgcgcgtggattttatggtaatgcgctg
aacggtactgtcaacgattgtatcgcgtgtccatgtcctgactctggtccttgtttattg
cataccgacgacgatatcatctgtttggactgtccgaacggctatgcaggacgccgatgt
gaaatttgttcagatggatatttcggcgaaccatcgaatggacgtaattgtacgttttgc
aaatgcagcggaaatattgatccaaattccgtcggcaattgcgacagaactactggagaa
tgtaaaaagtgtatttacaatacgcatggctttgaatgtgaaaaatgtttgcctggattc
tacggcgatgctctgttggaaccaaaaggagattgcaaaccttgcgattgttattcattc
ggtacctataaaccacgtacagattatgactttttggaatgtcaacaaaatgatggtcag
tgtcagtgtttaaatcatgtaactggtcgtcgatgtgaccaatgcgagaatggatattac
aatatcagcagcggtgaaggttgtcagccgtgcaactgcgatccgcttggttctttgaac
accagctgcgatataaacactggccagtgtgtttgcaagccgggtgtaattggacgtcgt
tgtgaccagtgcgcaatgcggcatttcggcttcggaccgaaaggttgcgaagcttgcaat
tgtctggtcatgggctctgtgaatttgcagtgcagcatcaccactggtcagtgtcagtgt
catccgaatatcgaaggacgacagtgtgatcgttgcaaagagaacatgtacaatttggaa
gccggatgcttggaatgtccaccatgttacaagctgatacagaaatatgccaaacaacat
cgggaaaagttggacgaattgaaagaccttcttgctgagattattgccaatccaatggtg
atcaatgatacgaattttgagaaaaagttggctgaagtgcacgaggatgtgacgaaattt
ggcgttgaggtgaaagaacgtttggctggtggtgacagttcattgatcaaacgagtgagc
aaattgcgagatgatattaccaaagcagaagaatcactagcggatgttgatcatttgttg
ttggaaacgaatttcacaatctccgaagcagtgaacataatgagcagttgggatagaatt
aaagaaaagtcttatgcagaactgcgacacgcgcagtactttttgaacaatgatgcggtt
gaggcgtggaacagagccagactagcgtctgatcgtttcggacgaccatcggaagaaatg
accaatttggcggaagaggcccgtcaattggctgaacggtaa

DBGET integrated database retrieval system