KEGG   Trichinella spiralis: Tsp_06024Help
Entry
Tsp_06024         CDS       T01609                                 

Definition
putative ribosomal protein S18
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 269 aa AA seqDB search
MLEMFQMLQIFNSAAVDSFFNCFFFIFTFTLAKLLFFYKSTPVEEIDNDQGKMASVNLEE
LGTNDVEKRKNKLRPIHPWPVSVKYMESEAYKQTYGNNLIWVLYRRNMKGPMHMLSRTRP
NCVDGDGRFRTNYPCPICRDEYLVVDYRNIKLLQQFIIPQTGQLVESRKSGLCGHQYLKL
RVEIAKATDCGYIPFTVPFRNYDYSEYYSWWPKGDNDHFVEEEPEFPAIEQQSPKLVYPT
HNPDVFPNMIRRRRNPFKQSPYRSGDRRR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatgtttcaaatgctgcaaatctttaattctgctgcagttgactcatttttc
aactgctttttcttcatattcacattcactcttgcgaagcttttatttttttacaaatca
acgccggttgaagaaattgataatgaccagggaaaaatggcttcagtaaatttggaggaa
ttgggtacgaatgatgtggagaaaagaaagaataaacttcggcctatacatccttggccc
gtcagtgtaaaatatatggaaagcgaagcctacaaacaaacgtatggtaataatctgatc
tgggttttgtaccgtcggaacatgaaaggtcctatgcacatgctatcaagaaccagacca
aattgtgttgacggagatggtcgtttcaggacaaactatccatgtccaatttgtcgcgat
gaatatttggtcgttgattaccgtaatattaaacttttacaacagttcatcattccgcaa
acaggccaacttgtggagagtcgaaaatctggcttgtgtgggcatcagtatttgaagttg
agagtggaaattgcgaaagccactgattgtggctacatcccttttacggtcccattccgc
aattacgattactcggaatattattcgtggtggcctaagggtgacaatgatcatttcgta
gaagaagaaccagaatttcctgctatcgaacaacagtcgccaaagttggtctatccaact
cacaatcctgatgtttttccgaatatgatacggcgcaggcggaatccttttaaacagagc
ccgtatcgatccggtgatcgaagacgataa

DBGET integrated database retrieval system