KEGG   Trichinella spiralis: Tsp_06198Help
Entry
Tsp_06198         CDS       T01609                                 

Definition
protein disulfide-isomerase 2
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tsp  Trichinella spiralis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tsp_06198
Enzymes [BR:tsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Tsp_06198
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Tsp_06198
  Exosomal proteins of colorectal cancer cells
   Tsp_06198
  Exosomal proteins of bladder cancer cells
   Tsp_06198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 492 aa AA seqDB search
MKLFVSFLALLVAFAWGEVTEEDHVMVLTNANFDKAISDHAYILVEFYAPWCGHCKALAP
EYAKAAKRLKDEGADVKLAKVDSTVETALAEKYAIRGYPTLKFFKDGNIIEYNGGRTAED
IISWVKKKSGPVAVQLEDAEAAEEFVKDALAAVGFFKKADSDKAKAFLDAAALIDDVKFG
MTSADAVYKALKAEGDGIVLFKPFDDGREVYEGEFEVEKLKNWILISSMPLVSDFTQETA
VRIFGGNIKSHMLLFCSKKADGFDKTLEEFTKAAKEYKGKLLFVTINADVEDNGRIMEFF
GLEKTELPTIRLINLGDDMLKYKPSFTEFKASDVIKFAKDFLDNKLKPHLLSQELPEDWD
KHPVKVLTGNNFASFIKTAGKPVLVEFYAPWCGHCKQLAPIWESLGEHYKDSDKVVIAKM
DATANEVEDIRINSFPTIMYFKNGALEGSHYGGARTLEALIKFVESDGVVGSQKGEDEAD
EDAPTGEAHEEL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcgtgtcttttctcgctcttctggtagcttttgcttggggtgaagtgact
gaagaggatcatgttatggttcttacgaatgcgaatttcgataaagccatttctgatcac
gcgtacattttggtcgaattctacgcaccgtggtgtggacattgtaaagcgttggcacct
gaatacgccaaagcagcaaaacgactgaaagacgaaggagcggatgtgaaattggcaaag
gttgactcgactgtggaaactgctttggcggaaaagtacgcaattcgcggttatccgacg
ttgaaatttttcaaagatggaaatataattgaatacaacggtggtcgtacggctgaagat
attatttcttgggtgaaaaagaaatcaggtcctgtggccgttcagctcgaagacgcagaa
gcggctgaagaatttgtcaaagatgccttggctgctgttggatttttcaaaaaggccgac
agtgataaggccaaggcctttttggatgcggctgcgttgattgacgacgtgaaattcggc
atgacctctgcggatgctgtttacaaagcgctgaaagccgaaggggacggcattgttttg
ttcaaaccatttgacgatggtcgtgaagtctacgaaggcgaattcgaagtggagaagctg
aaaaattggatcttgatcagcagtatgcctttagttagtgattttactcaagaaacggcc
gtcagaatattcggcggtaatatcaaatcgcacatgctgctcttctgtagcaagaaagcc
gatggatttgacaaaacgttggaagaattcaccaaagctgccaaagaatacaaaggaaaa
ttgttgtttgtcaccattaacgcggacgtggaagacaacggaaggatcatggaatttttt
ggcttagaaaagaccgaattgcctactattcgtttgatcaatctgggcgatgatatgctg
aagtacaagccatcttttactgaattcaaagcgtcggatgtgatcaaattcgcgaaagac
tttttggacaacaagttgaaaccgcatttgcttagtcaagaattgccagaagattgggac
aagcatccggtgaaggttttgactggtaacaattttgccagtttcataaaaacggccggc
aaacctgtgttagtcgaattttacgctccgtggtgtggtcattgtaagcagttggcacca
atttgggaatctttgggcgaacattacaaagacagcgacaaggtggtcattgccaaaatg
gatgctactgcgaacgaggttgaagacatccgcatcaattctttcccgacaattatgtat
ttcaaaaacggagcactggaaggcagtcattatggaggtgcgcgcacgttggaagctttg
attaagtttgtcgaatcggacggtgtagttggaagtcagaagggtgaagatgaagctgac
gaagatgcgcctaccggagaagcgcacgaagaattgtaa

DBGET integrated database retrieval system