KEGG   Trichinella spiralis: Tsp_06212Help
Entry
Tsp_06212         CDS       T01609                                 

Definition
putative histone acetyltransferase MYST1
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
tsp  Trichinella spiralis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 505 aa AA seqDB search
MLQLCLLQQLLKKILFNSRVSVRLDKFISLEKKQLLCKRFVQSSNCINTNDLDHSLFLFP
MTADDQCDVDEKMETSDSNSDDAAEHNLKALEDEMIIDMPSEDAEPLLGEFYMVRDSQNV
WRRAEVIQKRTNLLKNGEVEYFVHFDGDERRMDKWISRNDIDVSVCKTNECQHSPVDSAL
ESNLNVVQTRQQKRLNAEVPKTDDGHLDPHTAQLEKQREINTRIKYIAEIQLGNFRISTW
YFSCYPDEFLRPLLFICDRCMKYMKYVKTLKAHMKVCYSRPLPGRTVYRKNNLMVIEVDG
NESKLYCQFASLLGKLFIDHKTVCYLIGEFMFYVLYEVVDGEQHVAGFFSKEKRSTENNL
ACIVIFPPYQRKGYGSFLIQMSYAMSKREGIIGGPERPLSDIGRRAYRTYWAWEIVKLFA
KNIGVTMQISEIVEKTGIERHDVQDTLLEMNITYFYNGRRVVPVTMELVDRCINSPGYRV
PLTIFDENCLKWSPLVNATRKRNSI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaactttgtttactgcaacaactattaaaaaagatactcttcaattccagagta
tcagttcgactagataaattcatctcattagaaaaaaaacaactactttgtaaaagattt
gttcaaagttcaaattgtataaatacaaatgatcttgaccattcactgtttctgttcccg
atgactgcagatgaccagtgtgatgttgacgagaaaatggaaacgagcgattcaaacagt
gacgacgctgctgaacataatttgaaagcattagaagatgaaatgataattgatatgcct
tccgaagatgcggagccattgttgggcgaattttacatggttagagattcacaaaatgta
tggcgacgagctgaagtaattcagaaacgtacgaacttgttaaagaatggtgaagtggaa
tattttgttcattttgatggcgatgaacgccgtatggacaaatggataagcagaaatgat
atagacgtgtcggtgtgtaaaacaaacgaatgccagcatagtccagttgattcagcttta
gagtcaaatttgaacgtagtgcaaactcggcagcagaaacgtttgaacgcagaagttcct
aaaacggacgatggtcatcttgatccgcacacagcacaactggagaaacaacgtgaaatt
aatactcgaattaagtatattgcggaaattcagttgggtaattttcgaatcagtacatgg
tatttttcatgttatcccgatgaatttttacgaccgttgctatttatctgtgatcggtgt
atgaaatatatgaaatatgtgaaaactctgaaagcgcacatgaaagtttgttactcgaga
ccacttccgggtcgtacagtttaccgaaaaaataatcttatggtaatagaagttgatggt
aacgaatcgaaactttattgtcaatttgcatcacttttgggcaagttgttcattgaccac
aaaacggtgtgctacttaattggtgaattcatgttttacgttttgtacgaagtagtcgac
ggggaacagcacgttgctggatttttttccaaagaaaagcgttctacggaaaacaacttg
gcgtgcattgtgatttttccaccttatcagcgcaaaggttacggatcttttctgatacag
atgagttatgcaatgtcaaaaagagaaggaatcatcggtggaccagaacgtccattgtcc
gacattggcagacgagcttatcgtacttattgggcgtgggaaattgtaaaattgtttgcc
aaaaatattggcgttactatgcaaatttcagaaattgtagaaaaaactggaatagaacga
cacgatgtgcaggatactctgctggagatgaatattacttatttttacaatggtcgtcga
gtggtgccggttacaatggaattggtggatcgatgtatcaacagtcccggttatcgagtt
ccgttgacaattttcgatgaaaattgcttgaaatggtctccattggtgaacgcgacgcgt
aaacgaaattctatatga

DBGET integrated database retrieval system